BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060313.seq (688 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AE014297-3432|AAF56219.2| 267|Drosophila melanogaster CG33108-P... 56 3e-08 AY071230-1|AAL48852.1| 123|Drosophila melanogaster RE26840p pro... 56 5e-08 AY052144-1|AAK93568.1| 947|Drosophila melanogaster SD10334p pro... 29 7.9 AE014297-693|AAF54185.1| 947|Drosophila melanogaster CG2708-PA ... 29 7.9 >AE014297-3432|AAF56219.2| 267|Drosophila melanogaster CG33108-PA protein. Length = 267 Score = 56.4 bits (130), Expect = 3e-08 Identities = 38/107 (35%), Positives = 58/107 (54%), Gaps = 3/107 (2%) Frame = +2 Query: 353 NSCQWAAHYPELREACTKNNLFLEKEPFKYKYKYIESVLQVGPTCGLVALSM*LIEKLLP 532 + C WA YPE+++ C + + P +Y + S++QVGPTCGLVALSM L Sbjct: 38 DECTWACEYPEVQKGCYLSRVCQYTPPKHCQYYSVNSIVQVGPTCGLVALSMLLGGSPTA 97 Query: 533 ---MKC*ILQNYQATLGNGEMCSCKNMVKLVKEVFNLAGNK*CDLEL 664 +K I Q Y TL NGE+ S + + +L ++ ++ G C L + Sbjct: 98 DDLLKDAIDQEY--TL-NGELFSAQYLFELTRK--HMPGPAACQLHV 139 >AY071230-1|AAL48852.1| 123|Drosophila melanogaster RE26840p protein. Length = 123 Score = 56.0 bits (129), Expect = 5e-08 Identities = 23/52 (44%), Positives = 34/52 (65%) Frame = +2 Query: 353 NSCQWAAHYPELREACTKNNLFLEKEPFKYKYKYIESVLQVGPTCGLVALSM 508 + C WA YPE+++ C +++ P +Y + S++QVGPTCGLVALSM Sbjct: 38 DECTWACEYPEVQKGCYLSSVCQYTPPKHCQYYSVNSIVQVGPTCGLVALSM 89 >AY052144-1|AAK93568.1| 947|Drosophila melanogaster SD10334p protein. Length = 947 Score = 28.7 bits (61), Expect = 7.9 Identities = 11/34 (32%), Positives = 19/34 (55%) Frame = +2 Query: 344 VHFNSCQWAAHYPELREACTKNNLFLEKEPFKYK 445 VH+ + +WA E+R C ++ E E +KY+ Sbjct: 315 VHYTALEWAERLVEIRGLCRLLDVCSELEDYKYE 348 >AE014297-693|AAF54185.1| 947|Drosophila melanogaster CG2708-PA protein. Length = 947 Score = 28.7 bits (61), Expect = 7.9 Identities = 11/34 (32%), Positives = 19/34 (55%) Frame = +2 Query: 344 VHFNSCQWAAHYPELREACTKNNLFLEKEPFKYK 445 VH+ + +WA E+R C ++ E E +KY+ Sbjct: 315 VHYTALEWAERLVEIRGLCRLLDVCSELEDYKYE 348 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 24,059,962 Number of Sequences: 53049 Number of extensions: 441394 Number of successful extensions: 849 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 839 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 849 length of database: 24,988,368 effective HSP length: 82 effective length of database: 20,638,350 effective search space used: 3013199100 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -