BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060308.seq (656 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g31615.1 68417.m04491 transcriptional factor B3 family protei... 29 2.7 At3g45260.1 68416.m04887 zinc finger (C2H2 type) family protein ... 27 8.3 >At4g31615.1 68417.m04491 transcriptional factor B3 family protein low similarity to reproductive meristem gene 1 from [Brassica oleracea var. botrytis] GI:3170424, [Arabidopsis thaliana] GI:13604227; contains Pfam profile PF02362: B3 DNA binding domain Length = 478 Score = 29.1 bits (62), Expect = 2.7 Identities = 11/26 (42%), Positives = 16/26 (61%) Frame = +1 Query: 316 HALNVQCCVIFTWNKQCEPWPLGIRW 393 + LN +CC I NK + W LG+R+ Sbjct: 176 NGLNERCCEIDLMNKHGKSWTLGLRY 201 >At3g45260.1 68416.m04887 zinc finger (C2H2 type) family protein contains Pfam domain, PF00096: Zinc finger, C2H2 type Length = 446 Score = 27.5 bits (58), Expect = 8.3 Identities = 14/30 (46%), Positives = 15/30 (50%), Gaps = 3/30 (10%) Frame = -3 Query: 594 SDTRSWCLQFGQHATPDDQPPR---GTPTS 514 S RSW L H PD PP GTPT+ Sbjct: 413 SQHRSWPLLMVNHNLPDSSPPASTDGTPTA 442 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,205,195 Number of Sequences: 28952 Number of extensions: 229961 Number of successful extensions: 539 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 527 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 539 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1373722560 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -