BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060306.seq (687 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ667183-1|ABG75735.1| 463|Apis mellifera GABA-gated ion channe... 24 1.6 DQ244075-1|ABB36785.1| 548|Apis mellifera cytochrome P450 monoo... 21 8.3 >DQ667183-1|ABG75735.1| 463|Apis mellifera GABA-gated ion channel protein. Length = 463 Score = 23.8 bits (49), Expect = 1.6 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = -1 Query: 672 CHFGCDFSDSLTTPSQVEAD 613 C+F D S+S T+ + EAD Sbjct: 308 CYFSSDLSESETSSDEEEAD 327 >DQ244075-1|ABB36785.1| 548|Apis mellifera cytochrome P450 monooxygenase protein. Length = 548 Score = 21.4 bits (43), Expect = 8.3 Identities = 13/34 (38%), Positives = 19/34 (55%) Frame = -1 Query: 111 LSLASNEYTLRAPLTSVII*TTLEYHVISVYTHP 10 L LAS +YT+ A T V+I T + +Y +P Sbjct: 425 LKLASGDYTIPAGCT-VVIGTFKLHRQPHIYPNP 457 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 200,924 Number of Sequences: 438 Number of extensions: 4271 Number of successful extensions: 8 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 20952180 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -