BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060304.seq (631 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value X97819-1|CAA66399.1| 251|Tribolium castaneum ZEN Tc protein. 22 3.7 AF321227-4|AAK16424.1| 246|Tribolium castaneum Zen protein. 22 3.7 AM292336-1|CAL23148.2| 455|Tribolium castaneum gustatory recept... 21 6.4 AF321227-1|AAK16421.1| 290|Tribolium castaneum Ftz protein. 21 8.5 >X97819-1|CAA66399.1| 251|Tribolium castaneum ZEN Tc protein. Length = 251 Score = 22.2 bits (45), Expect = 3.7 Identities = 13/48 (27%), Positives = 21/48 (43%) Frame = +3 Query: 108 TSPRSPQT*RVSSKASTPAVSVTSTPMRRLCFRLLKTSPLRRPRSLYS 251 ++PRS SS + S S+ ++ RLL +P+ YS Sbjct: 152 STPRSSPAETASSLSPQSVASTASSADHQIVDRLLSHAPIDSANQWYS 199 >AF321227-4|AAK16424.1| 246|Tribolium castaneum Zen protein. Length = 246 Score = 22.2 bits (45), Expect = 3.7 Identities = 13/48 (27%), Positives = 21/48 (43%) Frame = +3 Query: 108 TSPRSPQT*RVSSKASTPAVSVTSTPMRRLCFRLLKTSPLRRPRSLYS 251 ++PRS SS + S S+ ++ RLL +P+ YS Sbjct: 143 STPRSSPAETASSLSPQSVASTASSADHQIVDRLLSHAPIDSANQWYS 190 >AM292336-1|CAL23148.2| 455|Tribolium castaneum gustatory receptor candidate 15 protein. Length = 455 Score = 21.4 bits (43), Expect = 6.4 Identities = 7/19 (36%), Positives = 13/19 (68%) Frame = +2 Query: 518 YFNIDVSQIDLRRPLQVLF 574 +F ID + R+P+++LF Sbjct: 301 FFEIDRINAESRKPIRILF 319 >AF321227-1|AAK16421.1| 290|Tribolium castaneum Ftz protein. Length = 290 Score = 21.0 bits (42), Expect = 8.5 Identities = 12/36 (33%), Positives = 18/36 (50%) Frame = +3 Query: 384 SH*AEAHGNVREEPAPHKGRH*ARXISLNHYFITVT 491 +H E + +V+EEP R LNH+ +VT Sbjct: 40 THNNEMYHSVKEEPIYESCRFSINQPYLNHFDNSVT 75 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 137,036 Number of Sequences: 336 Number of extensions: 2892 Number of successful extensions: 8 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 16188355 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -