BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060300.seq (686 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY008296-1|AAG22858.1| 556|Tribolium castaneum Dorsal protein. 22 4.1 AJ518941-1|CAD57735.1| 456|Tribolium castaneum homothorax protein. 22 4.1 DQ659248-1|ABG47446.1| 496|Tribolium castaneum chitinase 8 prot... 22 5.4 AJ415419-1|CAC94468.1| 441|Tribolium castaneum transcription fa... 22 5.4 AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like pr... 21 7.2 >AY008296-1|AAG22858.1| 556|Tribolium castaneum Dorsal protein. Length = 556 Score = 22.2 bits (45), Expect = 4.1 Identities = 13/42 (30%), Positives = 21/42 (50%) Frame = +2 Query: 506 TPTLTVPSCTWRRLRRRNSSPTSPCRPWRRLRSVSKPCLVSR 631 T +T P + +LRR + TS P+ L S+P ++ R Sbjct: 312 TLDITEPVKVFIQLRRPSDGATSEALPFELLPLDSEPGMLKR 353 Score = 21.4 bits (43), Expect = 7.2 Identities = 10/37 (27%), Positives = 19/37 (51%) Frame = -2 Query: 274 QTA*QNTPTPQRAKYLGDPNSQDSVGTAADAAMPPVC 164 +T QN ++ +PN DS+ A++A+ +C Sbjct: 510 ETFTQNLSLMDESEGRQEPNMTDSLTRLANSALDNIC 546 >AJ518941-1|CAD57735.1| 456|Tribolium castaneum homothorax protein. Length = 456 Score = 22.2 bits (45), Expect = 4.1 Identities = 13/42 (30%), Positives = 17/42 (40%) Frame = +3 Query: 510 LHLPYLRVPGGVCVGGIHRRHRPVAHGGG*GPYPNHAWFREH 635 +H Y+ G + H HRP G P+ NHA H Sbjct: 12 IHPGYMDGGAGAGLYEPHVAHRPGLQGLHHSPHLNHAMHPYH 53 >DQ659248-1|ABG47446.1| 496|Tribolium castaneum chitinase 8 protein. Length = 496 Score = 21.8 bits (44), Expect = 5.4 Identities = 12/52 (23%), Positives = 19/52 (36%) Frame = +2 Query: 461 YEVFKVAYAGMLDDETPTLTVPSCTWRRLRRRNSSPTSPCRPWRRLRSVSKP 616 Y++ A + DE P VP+ + + S PT + KP Sbjct: 376 YQILNAINAALKSDEIPPEPVPTPEPQPTQTTESEPTQASEQPTESSTTQKP 427 >AJ415419-1|CAC94468.1| 441|Tribolium castaneum transcription factor protein. Length = 441 Score = 21.8 bits (44), Expect = 5.4 Identities = 14/44 (31%), Positives = 21/44 (47%) Frame = +2 Query: 506 TPTLTVPSCTWRRLRRRNSSPTSPCRPWRRLRSVSKPCLVSRAP 637 T T+ + +CT L+ +SP RP + S+S P V P Sbjct: 247 TATVQLSTCTRTTLKNNRASPYPMQRP--KSASLSPPPHVYNPP 288 >AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like protein protein. Length = 1156 Score = 21.4 bits (43), Expect = 7.2 Identities = 8/17 (47%), Positives = 11/17 (64%) Frame = +3 Query: 624 FREHPPRSVAEXGQERR 674 ++EH RS+ E G RR Sbjct: 573 YKEHIMRSITESGGRRR 589 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 157,169 Number of Sequences: 336 Number of extensions: 3304 Number of successful extensions: 6 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 18010165 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -