BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060300.seq (686 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY568009-1|AAS73299.1| 300|Apis mellifera ADP/ATP translocase p... 33 0.003 AY332626-1|AAQ24500.1| 300|Apis mellifera ADP/ATP translocase p... 33 0.003 AF498306-5|AAM19330.1| 456|Apis mellifera dopamine receptor typ... 24 1.2 AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. 24 1.2 AJ276511-1|CAC06383.1| 352|Apis mellifera Antennapedia protein ... 23 2.1 DQ667183-1|ABG75735.1| 463|Apis mellifera GABA-gated ion channe... 23 3.6 AJ849455-1|CAH60991.1| 366|Apis mellifera twist protein protein. 22 6.3 >AY568009-1|AAS73299.1| 300|Apis mellifera ADP/ATP translocase protein. Length = 300 Score = 33.1 bits (72), Expect = 0.003 Identities = 23/94 (24%), Positives = 41/94 (43%), Gaps = 8/94 (8%) Frame = +2 Query: 260 LSCGLTXTAVVPLDLVKCRLQVX--------AEKYKNVVNGFKVSVREEGVRGLAKGWAP 415 ++ ++ T V P++ VK LQV ++YK +++ F +E+G +G Sbjct: 19 VAAAISKTTVAPIERVKLLLQVQHISKQISEEQRYKGMIDCFVRIPKEQGFLSYWRGNLA 78 Query: 416 TFIXYSMQGLCKFGFYEVFKVAYAGMLDDETPTL 517 I Y F F + +K + G +D T L Sbjct: 79 NVIRYFPTQALNFAFKDKYKQVFLGGVDKNTQFL 112 >AY332626-1|AAQ24500.1| 300|Apis mellifera ADP/ATP translocase protein. Length = 300 Score = 33.1 bits (72), Expect = 0.003 Identities = 23/94 (24%), Positives = 41/94 (43%), Gaps = 8/94 (8%) Frame = +2 Query: 260 LSCGLTXTAVVPLDLVKCRLQVX--------AEKYKNVVNGFKVSVREEGVRGLAKGWAP 415 ++ ++ T V P++ VK LQV ++YK +++ F +E+G +G Sbjct: 19 VAAAISKTTVAPIERVKLLLQVQHISKQISEEQRYKGMIDCFVRIPKEQGFLSYWRGNLA 78 Query: 416 TFIXYSMQGLCKFGFYEVFKVAYAGMLDDETPTL 517 I Y F F + +K + G +D T L Sbjct: 79 NVIRYFPTQALNFAFKDKYKQVFLGGVDKNTQFL 112 >AF498306-5|AAM19330.1| 456|Apis mellifera dopamine receptor type D2 protein. Length = 456 Score = 24.2 bits (50), Expect = 1.2 Identities = 9/29 (31%), Positives = 16/29 (55%) Frame = +3 Query: 492 CWTTRPLHLPYLRVPGGVCVGGIHRRHRP 578 CW+ R ++R+ C G + RR++P Sbjct: 392 CWS-RDFRRAFVRILCACCPGRVRRRYQP 419 >AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. Length = 898 Score = 24.2 bits (50), Expect = 1.2 Identities = 15/46 (32%), Positives = 19/46 (41%) Frame = +3 Query: 543 VCVGGIHRRHRPVAHGGG*GPYPNHAWFREHPPRSVAEXGQERRLR 680 VC+ RRHRPV G Y NH S + + R +R Sbjct: 105 VCMRKCPRRHRPVCASNG-KIYANHCELHRAACHSGSSLTKSRLMR 149 >AJ276511-1|CAC06383.1| 352|Apis mellifera Antennapedia protein protein. Length = 352 Score = 23.4 bits (48), Expect = 2.1 Identities = 10/30 (33%), Positives = 15/30 (50%) Frame = -2 Query: 307 HQVEGHHGRXGQTA*QNTPTPQRAKYLGDP 218 HQ + H+G Q Q Q+++ GDP Sbjct: 22 HQHQQHYGAAVQVPQQTQSVQQQSQQAGDP 51 >DQ667183-1|ABG75735.1| 463|Apis mellifera GABA-gated ion channel protein. Length = 463 Score = 22.6 bits (46), Expect = 3.6 Identities = 8/16 (50%), Positives = 10/16 (62%) Frame = -2 Query: 556 PPTQTPPGTRRYGKCR 509 PP QTPP + G+ R Sbjct: 395 PPRQTPPSRKESGRRR 410 >AJ849455-1|CAH60991.1| 366|Apis mellifera twist protein protein. Length = 366 Score = 21.8 bits (44), Expect = 6.3 Identities = 9/16 (56%), Positives = 11/16 (68%) Frame = -2 Query: 115 GPRNGEFRAASSNEEN 68 GPRNG+ + SS EN Sbjct: 210 GPRNGKRKRKSSTIEN 225 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 189,060 Number of Sequences: 438 Number of extensions: 4542 Number of successful extensions: 12 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 20952180 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -