BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060299.seq (556 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF002238-1|AAB97731.1| 327|Anopheles gambiae ribosomal protein ... 26 0.95 AB090821-2|BAC57918.1| 1168|Anopheles gambiae reverse transcript... 25 1.3 AY027891-1|AAK15783.1| 801|Anopheles gambiae collagen IV alpha ... 25 1.7 AF313909-1|AAL99382.1| 1024|Anopheles gambiae collagen IV alpha ... 25 2.2 DQ219483-1|ABB29887.1| 961|Anopheles gambiae cryptochrome 2 pro... 24 2.9 AJ439353-10|CAD27932.1| 3325|Anopheles gambiae F25C8.3 protein p... 24 3.9 AY390608-1|AAR27305.1| 242|Anopheles gambiae SP22D protein. 23 6.7 AY390607-1|AAR27304.1| 242|Anopheles gambiae SP22D protein. 23 6.7 AY390606-1|AAR27303.1| 241|Anopheles gambiae SP22D protein. 23 6.7 AY390605-1|AAR27302.1| 241|Anopheles gambiae SP22D protein. 23 6.7 AY390604-1|AAR27301.1| 241|Anopheles gambiae SP22D protein. 23 6.7 AY390603-1|AAR27300.1| 241|Anopheles gambiae SP22D protein. 23 6.7 AJ276428-1|CAB81934.1| 1322|Anopheles gambiae adhesive serine pr... 23 6.7 AF117751-1|AAD38337.3| 1322|Anopheles gambiae serine protease 22... 23 6.7 AY578799-1|AAT07304.1| 679|Anopheles gambiae brinker protein. 23 8.9 AJ130951-1|CAA10260.1| 189|Anopheles gambiae SG3 protein protein. 23 8.9 >AF002238-1|AAB97731.1| 327|Anopheles gambiae ribosomal protein L5 protein. Length = 327 Score = 25.8 bits (54), Expect = 0.95 Identities = 15/37 (40%), Positives = 21/37 (56%), Gaps = 1/37 (2%) Frame = -1 Query: 514 SAASTCRSDP*SRRLPWARAPPGWSRSWPCC-TPASR 407 +A ++ R P SRR P R+P R WP C +P +R Sbjct: 242 NAHASIRKIPPSRRNPRRRSPRSGGR-WPSCRSPPAR 277 Score = 24.6 bits (51), Expect = 2.2 Identities = 10/24 (41%), Positives = 15/24 (62%) Frame = +2 Query: 380 ANKGSWAPRA*SWSATRPTTRPSR 451 A + S + R SW +RPT++P R Sbjct: 276 ARRRSRSTRPTSWPRSRPTSKPKR 299 >AB090821-2|BAC57918.1| 1168|Anopheles gambiae reverse transcriptase protein. Length = 1168 Score = 25.4 bits (53), Expect = 1.3 Identities = 11/34 (32%), Positives = 19/34 (55%) Frame = -1 Query: 121 ALRGPVKLQLEGLMRRYLILVRCDVHSLFYRNIF 20 +LR ++L R+L +R DV +F+R +F Sbjct: 342 SLRKAIRLSKNEAFDRFLRSIREDVTGIFFRKVF 375 >AY027891-1|AAK15783.1| 801|Anopheles gambiae collagen IV alpha 1 chain precursor protein. Length = 801 Score = 25.0 bits (52), Expect = 1.7 Identities = 13/41 (31%), Positives = 19/41 (46%) Frame = +1 Query: 376 KCEQGFVGPKGVKLECNKANYETIQVVRGPKGAVYFKGQSG 498 K ++G+ G KG C + +RGP+G KG G Sbjct: 746 KGDKGYSGLKGEPGRCASIPPNLEEAIRGPQGLQGEKGAPG 786 >AF313909-1|AAL99382.1| 1024|Anopheles gambiae collagen IV alpha 1 chain protein. Length = 1024 Score = 24.6 bits (51), Expect = 2.2 Identities = 13/37 (35%), Positives = 21/37 (56%) Frame = +1 Query: 388 GFVGPKGVKLECNKANYETIQVVRGPKGAVYFKGQSG 498 GF+GPKG K E ++ + + + GP+G +G G Sbjct: 636 GFIGPKGDKGERDR---DGLNGLNGPQGMKGDRGMPG 669 >DQ219483-1|ABB29887.1| 961|Anopheles gambiae cryptochrome 2 protein. Length = 961 Score = 24.2 bits (50), Expect = 2.9 Identities = 8/24 (33%), Positives = 14/24 (58%) Frame = +1 Query: 25 CFCKTRSGRHSEPR*DIVS*DLPI 96 C+C + GR ++P D + LP+ Sbjct: 412 CYCPVKFGRKADPNGDYIRRYLPV 435 >AJ439353-10|CAD27932.1| 3325|Anopheles gambiae F25C8.3 protein protein. Length = 3325 Score = 23.8 bits (49), Expect = 3.9 Identities = 15/40 (37%), Positives = 17/40 (42%), Gaps = 1/40 (2%) Frame = +2 Query: 383 NKGSWAPRA*SWSATR-PTTRPSRWCAGPREPSTSRVRAA 499 N+G W SW PT RPS GPR + R A Sbjct: 1130 NRGQWP----SWMKQNLPTFRPSGPAMGPRTAMAAGTRRA 1165 >AY390608-1|AAR27305.1| 242|Anopheles gambiae SP22D protein. Length = 242 Score = 23.0 bits (47), Expect = 6.7 Identities = 10/19 (52%), Positives = 12/19 (63%) Frame = -1 Query: 154 PVPVLHGADVPALRGPVKL 98 PVP L+ + PA R P KL Sbjct: 165 PVPSLNSVNEPANRAPPKL 183 >AY390607-1|AAR27304.1| 242|Anopheles gambiae SP22D protein. Length = 242 Score = 23.0 bits (47), Expect = 6.7 Identities = 10/19 (52%), Positives = 12/19 (63%) Frame = -1 Query: 154 PVPVLHGADVPALRGPVKL 98 PVP L+ + PA R P KL Sbjct: 165 PVPSLNSVNEPANRAPPKL 183 >AY390606-1|AAR27303.1| 241|Anopheles gambiae SP22D protein. Length = 241 Score = 23.0 bits (47), Expect = 6.7 Identities = 10/19 (52%), Positives = 12/19 (63%) Frame = -1 Query: 154 PVPVLHGADVPALRGPVKL 98 PVP L+ + PA R P KL Sbjct: 164 PVPSLNSVNEPANRAPPKL 182 >AY390605-1|AAR27302.1| 241|Anopheles gambiae SP22D protein. Length = 241 Score = 23.0 bits (47), Expect = 6.7 Identities = 10/19 (52%), Positives = 12/19 (63%) Frame = -1 Query: 154 PVPVLHGADVPALRGPVKL 98 PVP L+ + PA R P KL Sbjct: 164 PVPSLNSVNEPANRAPPKL 182 >AY390604-1|AAR27301.1| 241|Anopheles gambiae SP22D protein. Length = 241 Score = 23.0 bits (47), Expect = 6.7 Identities = 10/19 (52%), Positives = 12/19 (63%) Frame = -1 Query: 154 PVPVLHGADVPALRGPVKL 98 PVP L+ + PA R P KL Sbjct: 164 PVPSLNSVNEPANRAPPKL 182 >AY390603-1|AAR27300.1| 241|Anopheles gambiae SP22D protein. Length = 241 Score = 23.0 bits (47), Expect = 6.7 Identities = 10/19 (52%), Positives = 12/19 (63%) Frame = -1 Query: 154 PVPVLHGADVPALRGPVKL 98 PVP L+ + PA R P KL Sbjct: 164 PVPSLNSVNEPANRAPPKL 182 >AJ276428-1|CAB81934.1| 1322|Anopheles gambiae adhesive serine protease protein. Length = 1322 Score = 23.0 bits (47), Expect = 6.7 Identities = 10/19 (52%), Positives = 12/19 (63%) Frame = -1 Query: 154 PVPVLHGADVPALRGPVKL 98 PVP L+ + PA R P KL Sbjct: 236 PVPSLNSVNEPANRAPPKL 254 >AF117751-1|AAD38337.3| 1322|Anopheles gambiae serine protease 22D protein. Length = 1322 Score = 23.0 bits (47), Expect = 6.7 Identities = 10/19 (52%), Positives = 12/19 (63%) Frame = -1 Query: 154 PVPVLHGADVPALRGPVKL 98 PVP L+ + PA R P KL Sbjct: 235 PVPSLNSVNEPANRAPPKL 253 >AY578799-1|AAT07304.1| 679|Anopheles gambiae brinker protein. Length = 679 Score = 22.6 bits (46), Expect = 8.9 Identities = 13/39 (33%), Positives = 20/39 (51%) Frame = +2 Query: 386 KGSWAPRA*SWSATRPTTRPSRWCAGPREPSTSRVRAAS 502 +G +P+A S +T S C+GP E + S A+S Sbjct: 553 RGWSSPQASPVSGYDSSTSISSVCSGPEEDNASHSSASS 591 >AJ130951-1|CAA10260.1| 189|Anopheles gambiae SG3 protein protein. Length = 189 Score = 22.6 bits (46), Expect = 8.9 Identities = 10/24 (41%), Positives = 10/24 (41%) Frame = -1 Query: 475 RLPWARAPPGWSRSWPCCTPASRP 404 R PW PP R W P RP Sbjct: 93 RPPWHPRPPFGGRPWWLRPPFHRP 116 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 542,614 Number of Sequences: 2352 Number of extensions: 10560 Number of successful extensions: 84 Number of sequences better than 10.0: 16 Number of HSP's better than 10.0 without gapping: 77 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 84 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 51722361 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -