BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060295.seq (673 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U40942-9|AAC47074.6| 703|Caenorhabditis elegans Synaptogenesis ... 31 0.99 U40427-1|AAA81467.2| 798|Caenorhabditis elegans Hypothetical pr... 28 5.3 >U40942-9|AAC47074.6| 703|Caenorhabditis elegans Synaptogenesis abnormal protein 1 protein. Length = 703 Score = 30.7 bits (66), Expect = 0.99 Identities = 14/39 (35%), Positives = 22/39 (56%), Gaps = 1/39 (2%) Frame = -3 Query: 257 IGTTRGILKMNLGFGCS*IESKGNMPAN-GEGSLIACIT 144 IGTTRG +K+N+ FG + + + N G+ + C T Sbjct: 342 IGTTRGSIKLNVAFGARIMSTSQDKEVNEGDNAFFHCAT 380 >U40427-1|AAA81467.2| 798|Caenorhabditis elegans Hypothetical protein F43C9.3 protein. Length = 798 Score = 28.3 bits (60), Expect = 5.3 Identities = 13/20 (65%), Positives = 14/20 (70%), Gaps = 1/20 (5%) Frame = -2 Query: 513 NRI-RCELFHFPFESRSRGC 457 NR+ R L HFP ES SRGC Sbjct: 374 NRLHRISLKHFPIESMSRGC 393 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,670,481 Number of Sequences: 27780 Number of extensions: 303495 Number of successful extensions: 804 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 771 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 804 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1518563232 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -