BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= NV060294.seq
(677 letters)
Database: human
237,096 sequences; 76,859,062 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
AF195420-1|AAF28318.1| 442|Homo sapiens ODZ3 protein. 30 6.6
>AF195420-1|AAF28318.1| 442|Homo sapiens ODZ3 protein.
Length = 442
Score = 30.3 bits (65), Expect = 6.6
Identities = 20/64 (31%), Positives = 28/64 (43%), Gaps = 1/64 (1%)
Frame = -2
Query: 634 SNNPVRHAVHLLTSTATHTRRICHDAVPGYSGVHASAPSTETLLLVAKXTARGV-RYKSA 458
SN P+ H L T T T + A PGY+ S S T L +R ++K +
Sbjct: 243 SNVPLESR-HFLFKTGTGTTPLFSTATPGYTMASGSVYSPPTRPLPRNTLSRSAFKFKKS 301
Query: 457 TAYC 446
+ YC
Sbjct: 302 SKYC 305
Database: human
Posted date: Oct 23, 2007 1:18 PM
Number of letters in database: 76,859,062
Number of sequences in database: 237,096
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 93,330,169
Number of Sequences: 237096
Number of extensions: 1860580
Number of successful extensions: 3691
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 3555
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 3691
length of database: 76,859,062
effective HSP length: 88
effective length of database: 55,994,614
effective search space used: 7671262118
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -