BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060294.seq (677 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value L16679-1|AAA28092.5| 2104|Caenorhabditis elegans Muscle position... 30 1.3 AF289202-1|AAK69172.1| 2104|Caenorhabditis elegans transmembrane... 30 1.3 Z49907-4|CAA90086.1| 454|Caenorhabditis elegans Hypothetical pr... 27 9.3 >L16679-1|AAA28092.5| 2104|Caenorhabditis elegans Muscle positioning protein 4 protein. Length = 2104 Score = 30.3 bits (65), Expect = 1.3 Identities = 16/55 (29%), Positives = 25/55 (45%), Gaps = 1/55 (1%) Frame = -1 Query: 593 HCYTHPPNLP*RCSRVLRCTCVSPF-DGNLAAGGKNXCAWRSVQECDSVLRLDCT 432 H HP + + CTC F D N + G+N ++R V EC+ +C+ Sbjct: 1628 HSDCHPDAICKEVGKGYTCTCPDGFRDLNPSRPGRNCLSYRGVNECEKPELNECS 1682 >AF289202-1|AAK69172.1| 2104|Caenorhabditis elegans transmembrane matrix receptor MUP-4 protein. Length = 2104 Score = 30.3 bits (65), Expect = 1.3 Identities = 16/55 (29%), Positives = 25/55 (45%), Gaps = 1/55 (1%) Frame = -1 Query: 593 HCYTHPPNLP*RCSRVLRCTCVSPF-DGNLAAGGKNXCAWRSVQECDSVLRLDCT 432 H HP + + CTC F D N + G+N ++R V EC+ +C+ Sbjct: 1628 HSDCHPDAICKEVGKGYTCTCPDGFRDLNPSRPGRNCLSYRGVNECEKPELNECS 1682 >Z49907-4|CAA90086.1| 454|Caenorhabditis elegans Hypothetical protein B0491.4 protein. Length = 454 Score = 27.5 bits (58), Expect = 9.3 Identities = 12/36 (33%), Positives = 21/36 (58%) Frame = +3 Query: 240 SHQRCMTARILDFGVCCINHRRDRAVCRKSKTPTPQ 347 SH+ ++A++++ VCCI R A R + TP+ Sbjct: 365 SHRLFLSAKLINRVVCCIEPERSDAYHRYVEEDTPE 400 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,103,531 Number of Sequences: 27780 Number of extensions: 308891 Number of successful extensions: 625 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 599 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 625 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1539654388 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -