BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060293.seq (679 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC1604.15 |gpi16||pig-T |Schizosaccharomyces pombe|chr 2|||Manual 30 0.35 SPAC20G8.09c |||N-acetyltransferase Nat10 |Schizosaccharomyces p... 25 7.6 >SPBC1604.15 |gpi16||pig-T |Schizosaccharomyces pombe|chr 2|||Manual Length = 545 Score = 29.9 bits (64), Expect = 0.35 Identities = 16/45 (35%), Positives = 22/45 (48%) Frame = -1 Query: 430 RSLSPSARAWQNTYSALYNVHSSAKRLLTNFSLPIIVRIVLSHLT 296 RSLS W + S +YN SS + ++ P VR+ L LT Sbjct: 343 RSLSNDGNHWGSLSSTIYNPSSSPRTIVYFEKFPWFVRVYLHTLT 387 >SPAC20G8.09c |||N-acetyltransferase Nat10 |Schizosaccharomyces pombe|chr 1|||Manual Length = 1033 Score = 25.4 bits (53), Expect = 7.6 Identities = 9/18 (50%), Positives = 11/18 (61%) Frame = -3 Query: 326 NCANCVVTSDHSKVFPMS 273 NC NC+V D V P+S Sbjct: 194 NCENCLVIDDELNVLPIS 211 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,552,301 Number of Sequences: 5004 Number of extensions: 44795 Number of successful extensions: 143 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 140 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 143 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 311890690 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -