BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060293.seq (679 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_42672| Best HMM Match : DUF755 (HMM E-Value=8.1) 32 0.37 SB_31768| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.65 >SB_42672| Best HMM Match : DUF755 (HMM E-Value=8.1) Length = 159 Score = 32.3 bits (70), Expect = 0.37 Identities = 13/31 (41%), Positives = 20/31 (64%) Frame = +2 Query: 317 SHNYWQRKVCKETFGRAVHIVQRRVRVLPGT 409 +H+Y++R C+E F R H++ VLPGT Sbjct: 19 NHHYFRRTACRELFCRRNHLIPFGWPVLPGT 49 >SB_31768| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 725 Score = 31.5 bits (68), Expect = 0.65 Identities = 12/40 (30%), Positives = 22/40 (55%) Frame = -3 Query: 380 VQCAQLGQTSPYKLFVANNCANCVVTSDHSKVFPMSSRFT 261 +QC +L P+K+ ++ CA C V +P ++R+T Sbjct: 473 IQCPRLDCPKPFKMHPSDCCAQCPVCKFGQNTYPNNARWT 512 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,122,170 Number of Sequences: 59808 Number of extensions: 340398 Number of successful extensions: 1141 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1069 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1141 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1745338465 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -