BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060292.seq (687 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value X59303-1|CAA41990.1| 1265|Homo sapiens valyl-tRNA synthetase pro... 31 2.9 M98326-1|AAA81332.1| 1063|Homo sapiens valyl-tRNA synthetase pro... 31 2.9 BX248133-11|CAM26113.1| 1182|Homo sapiens valyl-tRNA synthetase ... 31 2.9 BC012808-1|AAH12808.1| 1264|Homo sapiens valyl-tRNA synthetase p... 31 2.9 BA000025-12|BAB63303.1| 1264|Homo sapiens valyl tRNA synthetase ... 31 2.9 AL671762-1|CAI18211.1| 1264|Homo sapiens valyl-tRNA synthetase p... 31 2.9 AL662899-2|CAI18384.1| 1264|Homo sapiens valyl-tRNA synthetase p... 31 2.9 AL662834-12|CAI17732.1| 1264|Homo sapiens valyl-tRNA synthetase ... 31 2.9 AF134726-10|AAD21819.1| 1264|Homo sapiens G7A protein. 31 2.9 AF315632-1|AAK77961.1| 669|Homo sapiens coactivator activator p... 31 5.1 >X59303-1|CAA41990.1| 1265|Homo sapiens valyl-tRNA synthetase protein. Length = 1265 Score = 31.5 bits (68), Expect = 2.9 Identities = 11/30 (36%), Positives = 18/30 (60%) Frame = +3 Query: 354 WRSQELESTVDTVLKMVHLIRSTRVEYNLT 443 W+ E E+ ++ L + +RS R +YNLT Sbjct: 1100 WKDPEAEAALELALSITRAVRSLRADYNLT 1129 >M98326-1|AAA81332.1| 1063|Homo sapiens valyl-tRNA synthetase protein. Length = 1063 Score = 31.5 bits (68), Expect = 2.9 Identities = 11/30 (36%), Positives = 18/30 (60%) Frame = +3 Query: 354 WRSQELESTVDTVLKMVHLIRSTRVEYNLT 443 W+ E E+ ++ L + +RS R +YNLT Sbjct: 899 WKDPEAEAALELALSITRAVRSLRADYNLT 928 >BX248133-11|CAM26113.1| 1182|Homo sapiens valyl-tRNA synthetase protein. Length = 1182 Score = 31.5 bits (68), Expect = 2.9 Identities = 11/30 (36%), Positives = 18/30 (60%) Frame = +3 Query: 354 WRSQELESTVDTVLKMVHLIRSTRVEYNLT 443 W+ E E+ ++ L + +RS R +YNLT Sbjct: 1017 WKDPEAEAALELALSITRAVRSLRADYNLT 1046 >BC012808-1|AAH12808.1| 1264|Homo sapiens valyl-tRNA synthetase protein. Length = 1264 Score = 31.5 bits (68), Expect = 2.9 Identities = 11/30 (36%), Positives = 18/30 (60%) Frame = +3 Query: 354 WRSQELESTVDTVLKMVHLIRSTRVEYNLT 443 W+ E E+ ++ L + +RS R +YNLT Sbjct: 1099 WKDPEAEAALELALSITRAVRSLRADYNLT 1128 >BA000025-12|BAB63303.1| 1264|Homo sapiens valyl tRNA synthetase protein. Length = 1264 Score = 31.5 bits (68), Expect = 2.9 Identities = 11/30 (36%), Positives = 18/30 (60%) Frame = +3 Query: 354 WRSQELESTVDTVLKMVHLIRSTRVEYNLT 443 W+ E E+ ++ L + +RS R +YNLT Sbjct: 1099 WKDPEAEAALELALSITRAVRSLRADYNLT 1128 >AL671762-1|CAI18211.1| 1264|Homo sapiens valyl-tRNA synthetase protein. Length = 1264 Score = 31.5 bits (68), Expect = 2.9 Identities = 11/30 (36%), Positives = 18/30 (60%) Frame = +3 Query: 354 WRSQELESTVDTVLKMVHLIRSTRVEYNLT 443 W+ E E+ ++ L + +RS R +YNLT Sbjct: 1099 WKDPEAEAALELALSITRAVRSLRADYNLT 1128 >AL662899-2|CAI18384.1| 1264|Homo sapiens valyl-tRNA synthetase protein. Length = 1264 Score = 31.5 bits (68), Expect = 2.9 Identities = 11/30 (36%), Positives = 18/30 (60%) Frame = +3 Query: 354 WRSQELESTVDTVLKMVHLIRSTRVEYNLT 443 W+ E E+ ++ L + +RS R +YNLT Sbjct: 1099 WKDPEAEAALELALSITRAVRSLRADYNLT 1128 >AL662834-12|CAI17732.1| 1264|Homo sapiens valyl-tRNA synthetase protein. Length = 1264 Score = 31.5 bits (68), Expect = 2.9 Identities = 11/30 (36%), Positives = 18/30 (60%) Frame = +3 Query: 354 WRSQELESTVDTVLKMVHLIRSTRVEYNLT 443 W+ E E+ ++ L + +RS R +YNLT Sbjct: 1099 WKDPEAEAALELALSITRAVRSLRADYNLT 1128 >AF134726-10|AAD21819.1| 1264|Homo sapiens G7A protein. Length = 1264 Score = 31.5 bits (68), Expect = 2.9 Identities = 11/30 (36%), Positives = 18/30 (60%) Frame = +3 Query: 354 WRSQELESTVDTVLKMVHLIRSTRVEYNLT 443 W+ E E+ ++ L + +RS R +YNLT Sbjct: 1099 WKDPEAEAALELALSITRAVRSLRADYNLT 1128 >AF315632-1|AAK77961.1| 669|Homo sapiens coactivator activator protein. Length = 669 Score = 30.7 bits (66), Expect = 5.1 Identities = 17/69 (24%), Positives = 30/69 (43%), Gaps = 1/69 (1%) Frame = +2 Query: 326 NKFPGSGYAVAFAGTRIDSGHGTQNGSPDPFDSRRIQPDQQT-EDPARNSTG*CLG*GAR 502 N + G+G A T N +P P++ R+ P + + +DP + + G+ Sbjct: 546 NAYDGAGQPSAAYLTMSQGAVANANSTPPPYERTRLSPPRASYDDPYKKAVAMSKRYGSD 605 Query: 503 RTFAEFDEY 529 R AE +Y Sbjct: 606 RRLAELSDY 614 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 92,067,752 Number of Sequences: 237096 Number of extensions: 1899024 Number of successful extensions: 4910 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 4812 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4910 length of database: 76,859,062 effective HSP length: 88 effective length of database: 55,994,614 effective search space used: 7839245960 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -