BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060286.seq (677 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ219482-1|ABB29886.1| 545|Anopheles gambiae cryptochrome 1 pro... 26 1.3 DQ080831-1|AAY89477.1| 170|Anopheles gambiae transcription fact... 25 1.7 DQ080830-1|AAY89476.1| 170|Anopheles gambiae transcription fact... 25 1.7 DQ080829-1|AAY89475.1| 170|Anopheles gambiae transcription fact... 25 1.7 DQ080828-1|AAY89474.1| 170|Anopheles gambiae transcription fact... 25 1.7 DQ080827-1|AAY89473.1| 170|Anopheles gambiae transcription fact... 25 1.7 DQ080826-1|AAY89472.1| 170|Anopheles gambiae transcription fact... 25 1.7 DQ080825-1|AAY89471.1| 170|Anopheles gambiae transcription fact... 25 1.7 DQ080824-1|AAY89470.1| 170|Anopheles gambiae transcription fact... 25 1.7 DQ080823-1|AAY89469.1| 170|Anopheles gambiae transcription fact... 25 1.7 DQ080822-1|AAY89468.1| 170|Anopheles gambiae transcription fact... 25 1.7 DQ080821-1|AAY89467.1| 170|Anopheles gambiae transcription fact... 25 1.7 DQ080820-1|AAY89466.1| 170|Anopheles gambiae transcription fact... 25 1.7 DQ080819-1|AAY89465.1| 170|Anopheles gambiae transcription fact... 25 1.7 DQ080818-1|AAY89464.1| 170|Anopheles gambiae transcription fact... 25 1.7 DQ080817-1|AAY89463.1| 170|Anopheles gambiae transcription fact... 25 1.7 DQ080816-1|AAY89462.1| 170|Anopheles gambiae transcription fact... 25 1.7 DQ080815-1|AAY89461.1| 170|Anopheles gambiae transcription fact... 25 1.7 DQ080814-1|AAY89460.1| 170|Anopheles gambiae transcription fact... 25 1.7 DQ080813-1|AAY89459.1| 170|Anopheles gambiae transcription fact... 25 1.7 DQ080812-1|AAY89458.1| 170|Anopheles gambiae transcription fact... 25 1.7 DQ080811-1|AAY89457.1| 170|Anopheles gambiae transcription fact... 25 1.7 DQ080810-1|AAY89456.1| 170|Anopheles gambiae transcription fact... 25 1.7 DQ080809-1|AAY89455.1| 170|Anopheles gambiae transcription fact... 25 1.7 DQ080808-1|AAY89454.1| 170|Anopheles gambiae transcription fact... 25 1.7 DQ080807-1|AAY89453.1| 154|Anopheles gambiae transcription fact... 25 1.7 DQ080806-1|AAY89452.1| 154|Anopheles gambiae transcription fact... 25 1.7 DQ080805-1|AAY89451.1| 170|Anopheles gambiae transcription fact... 25 1.7 DQ080804-1|AAY89450.1| 170|Anopheles gambiae transcription fact... 25 1.7 DQ080803-1|AAY89449.1| 170|Anopheles gambiae transcription fact... 25 1.7 DQ080802-1|AAY89448.1| 170|Anopheles gambiae transcription fact... 25 1.7 DQ080801-1|AAY89447.1| 170|Anopheles gambiae transcription fact... 25 1.7 DQ080800-1|AAY89446.1| 170|Anopheles gambiae transcription fact... 25 1.7 DQ080799-1|AAY89445.1| 170|Anopheles gambiae transcription fact... 25 1.7 DQ080798-1|AAY89444.1| 170|Anopheles gambiae transcription fact... 25 1.7 DQ080797-1|AAY89443.1| 170|Anopheles gambiae transcription fact... 25 1.7 DQ080796-1|AAY89442.1| 170|Anopheles gambiae transcription fact... 25 1.7 DQ080795-1|AAY89441.1| 170|Anopheles gambiae transcription fact... 25 1.7 DQ080794-1|AAY89440.1| 170|Anopheles gambiae transcription fact... 25 1.7 DQ080793-1|AAY89439.1| 170|Anopheles gambiae transcription fact... 25 1.7 DQ080792-1|AAY89438.1| 170|Anopheles gambiae transcription fact... 25 1.7 DQ080791-1|AAY89437.1| 170|Anopheles gambiae transcription fact... 25 1.7 DQ080790-1|AAY89436.1| 170|Anopheles gambiae transcription fact... 25 1.7 DQ080789-1|AAY89435.1| 170|Anopheles gambiae transcription fact... 25 1.7 DQ080788-1|AAY89434.1| 170|Anopheles gambiae transcription fact... 25 1.7 AJ302655-1|CAC35520.1| 332|Anopheles gambiae gSG5 protein protein. 25 1.7 AB090813-1|BAC57901.1| 724|Anopheles gambiae gag-like protein p... 25 1.7 AY017417-1|AAG54081.1| 383|Anopheles gambiae arrestin protein. 23 8.9 AJ697727-1|CAG26920.1| 285|Anopheles gambiae putative odorant-b... 23 8.9 AJ304409-1|CAC39103.2| 383|Anopheles gambiae arrestin protein. 23 8.9 AF492464-1|AAM11657.1| 803|Anopheles gambiae beta nu integrin s... 23 8.9 >DQ219482-1|ABB29886.1| 545|Anopheles gambiae cryptochrome 1 protein. Length = 545 Score = 25.8 bits (54), Expect = 1.3 Identities = 8/29 (27%), Positives = 18/29 (62%) Frame = -1 Query: 338 VYKWFFLTLRLKNPLHPSQDEAP*CLPVP 252 +++ +F T+ ++NP + + P CL +P Sbjct: 310 IWREYFYTMSVQNPHYGEMERNPICLNIP 338 >DQ080831-1|AAY89477.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 25.4 bits (53), Expect = 1.7 Identities = 11/25 (44%), Positives = 16/25 (64%) Frame = -1 Query: 476 RLQLILSLSF*TASFFMPALKHFLN 402 R+ L + S T SF+ PAL ++LN Sbjct: 33 RMPLFIFCSIFTFSFYTPALDYYLN 57 >DQ080830-1|AAY89476.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 25.4 bits (53), Expect = 1.7 Identities = 11/25 (44%), Positives = 16/25 (64%) Frame = -1 Query: 476 RLQLILSLSF*TASFFMPALKHFLN 402 R+ L + S T SF+ PAL ++LN Sbjct: 33 RMPLFIFCSIFTFSFYTPALDYYLN 57 >DQ080829-1|AAY89475.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 25.4 bits (53), Expect = 1.7 Identities = 11/25 (44%), Positives = 16/25 (64%) Frame = -1 Query: 476 RLQLILSLSF*TASFFMPALKHFLN 402 R+ L + S T SF+ PAL ++LN Sbjct: 33 RMPLFIFCSIFTFSFYTPALDYYLN 57 >DQ080828-1|AAY89474.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 25.4 bits (53), Expect = 1.7 Identities = 11/25 (44%), Positives = 16/25 (64%) Frame = -1 Query: 476 RLQLILSLSF*TASFFMPALKHFLN 402 R+ L + S T SF+ PAL ++LN Sbjct: 33 RMPLFIFCSIFTFSFYTPALDYYLN 57 >DQ080827-1|AAY89473.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 25.4 bits (53), Expect = 1.7 Identities = 11/25 (44%), Positives = 16/25 (64%) Frame = -1 Query: 476 RLQLILSLSF*TASFFMPALKHFLN 402 R+ L + S T SF+ PAL ++LN Sbjct: 33 RMPLFIFCSIFTFSFYTPALDYYLN 57 >DQ080826-1|AAY89472.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 25.4 bits (53), Expect = 1.7 Identities = 11/25 (44%), Positives = 16/25 (64%) Frame = -1 Query: 476 RLQLILSLSF*TASFFMPALKHFLN 402 R+ L + S T SF+ PAL ++LN Sbjct: 33 RMPLFIFCSIFTFSFYTPALDYYLN 57 >DQ080825-1|AAY89471.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 25.4 bits (53), Expect = 1.7 Identities = 11/25 (44%), Positives = 16/25 (64%) Frame = -1 Query: 476 RLQLILSLSF*TASFFMPALKHFLN 402 R+ L + S T SF+ PAL ++LN Sbjct: 33 RMPLFIFCSIFTFSFYTPALDYYLN 57 >DQ080824-1|AAY89470.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 25.4 bits (53), Expect = 1.7 Identities = 11/25 (44%), Positives = 16/25 (64%) Frame = -1 Query: 476 RLQLILSLSF*TASFFMPALKHFLN 402 R+ L + S T SF+ PAL ++LN Sbjct: 33 RMPLFIFCSIFTFSFYTPALDYYLN 57 >DQ080823-1|AAY89469.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 25.4 bits (53), Expect = 1.7 Identities = 11/25 (44%), Positives = 16/25 (64%) Frame = -1 Query: 476 RLQLILSLSF*TASFFMPALKHFLN 402 R+ L + S T SF+ PAL ++LN Sbjct: 33 RMPLFIFCSIFTFSFYTPALDYYLN 57 >DQ080822-1|AAY89468.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 25.4 bits (53), Expect = 1.7 Identities = 11/25 (44%), Positives = 16/25 (64%) Frame = -1 Query: 476 RLQLILSLSF*TASFFMPALKHFLN 402 R+ L + S T SF+ PAL ++LN Sbjct: 33 RMPLFIFCSIFTFSFYTPALDYYLN 57 >DQ080821-1|AAY89467.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 25.4 bits (53), Expect = 1.7 Identities = 11/25 (44%), Positives = 16/25 (64%) Frame = -1 Query: 476 RLQLILSLSF*TASFFMPALKHFLN 402 R+ L + S T SF+ PAL ++LN Sbjct: 33 RMPLFIFCSIFTFSFYTPALDYYLN 57 >DQ080820-1|AAY89466.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 25.4 bits (53), Expect = 1.7 Identities = 11/25 (44%), Positives = 16/25 (64%) Frame = -1 Query: 476 RLQLILSLSF*TASFFMPALKHFLN 402 R+ L + S T SF+ PAL ++LN Sbjct: 33 RMPLFIFCSIFTFSFYTPALDYYLN 57 >DQ080819-1|AAY89465.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 25.4 bits (53), Expect = 1.7 Identities = 11/25 (44%), Positives = 16/25 (64%) Frame = -1 Query: 476 RLQLILSLSF*TASFFMPALKHFLN 402 R+ L + S T SF+ PAL ++LN Sbjct: 33 RMPLFIFCSIFTFSFYTPALDYYLN 57 >DQ080818-1|AAY89464.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 25.4 bits (53), Expect = 1.7 Identities = 11/25 (44%), Positives = 16/25 (64%) Frame = -1 Query: 476 RLQLILSLSF*TASFFMPALKHFLN 402 R+ L + S T SF+ PAL ++LN Sbjct: 33 RMPLFIFCSIFTFSFYTPALDYYLN 57 >DQ080817-1|AAY89463.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 25.4 bits (53), Expect = 1.7 Identities = 11/25 (44%), Positives = 16/25 (64%) Frame = -1 Query: 476 RLQLILSLSF*TASFFMPALKHFLN 402 R+ L + S T SF+ PAL ++LN Sbjct: 33 RMPLFIFCSIFTFSFYTPALDYYLN 57 >DQ080816-1|AAY89462.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 25.4 bits (53), Expect = 1.7 Identities = 11/25 (44%), Positives = 16/25 (64%) Frame = -1 Query: 476 RLQLILSLSF*TASFFMPALKHFLN 402 R+ L + S T SF+ PAL ++LN Sbjct: 33 RMPLFIFCSIFTFSFYTPALDYYLN 57 >DQ080815-1|AAY89461.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 25.4 bits (53), Expect = 1.7 Identities = 11/25 (44%), Positives = 16/25 (64%) Frame = -1 Query: 476 RLQLILSLSF*TASFFMPALKHFLN 402 R+ L + S T SF+ PAL ++LN Sbjct: 33 RMPLFIFCSIFTFSFYTPALDYYLN 57 >DQ080814-1|AAY89460.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 25.4 bits (53), Expect = 1.7 Identities = 11/25 (44%), Positives = 16/25 (64%) Frame = -1 Query: 476 RLQLILSLSF*TASFFMPALKHFLN 402 R+ L + S T SF+ PAL ++LN Sbjct: 33 RMPLFIFCSIFTFSFYTPALDYYLN 57 >DQ080813-1|AAY89459.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 25.4 bits (53), Expect = 1.7 Identities = 11/25 (44%), Positives = 16/25 (64%) Frame = -1 Query: 476 RLQLILSLSF*TASFFMPALKHFLN 402 R+ L + S T SF+ PAL ++LN Sbjct: 33 RMPLFIFCSIFTFSFYTPALDYYLN 57 >DQ080812-1|AAY89458.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 25.4 bits (53), Expect = 1.7 Identities = 11/25 (44%), Positives = 16/25 (64%) Frame = -1 Query: 476 RLQLILSLSF*TASFFMPALKHFLN 402 R+ L + S T SF+ PAL ++LN Sbjct: 33 RMPLFIFCSIFTFSFYTPALDYYLN 57 >DQ080811-1|AAY89457.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 25.4 bits (53), Expect = 1.7 Identities = 11/25 (44%), Positives = 16/25 (64%) Frame = -1 Query: 476 RLQLILSLSF*TASFFMPALKHFLN 402 R+ L + S T SF+ PAL ++LN Sbjct: 33 RMPLFIFCSIFTFSFYTPALDYYLN 57 >DQ080810-1|AAY89456.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 25.4 bits (53), Expect = 1.7 Identities = 11/25 (44%), Positives = 16/25 (64%) Frame = -1 Query: 476 RLQLILSLSF*TASFFMPALKHFLN 402 R+ L + S T SF+ PAL ++LN Sbjct: 33 RMPLFIFCSIFTFSFYTPALDYYLN 57 >DQ080809-1|AAY89455.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 25.4 bits (53), Expect = 1.7 Identities = 11/25 (44%), Positives = 16/25 (64%) Frame = -1 Query: 476 RLQLILSLSF*TASFFMPALKHFLN 402 R+ L + S T SF+ PAL ++LN Sbjct: 33 RMPLFIFCSIFTFSFYTPALDYYLN 57 >DQ080808-1|AAY89454.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 25.4 bits (53), Expect = 1.7 Identities = 11/25 (44%), Positives = 16/25 (64%) Frame = -1 Query: 476 RLQLILSLSF*TASFFMPALKHFLN 402 R+ L + S T SF+ PAL ++LN Sbjct: 33 RMPLFIFCSIFTFSFYTPALDYYLN 57 >DQ080807-1|AAY89453.1| 154|Anopheles gambiae transcription factor 3C protein. Length = 154 Score = 25.4 bits (53), Expect = 1.7 Identities = 11/25 (44%), Positives = 16/25 (64%) Frame = -1 Query: 476 RLQLILSLSF*TASFFMPALKHFLN 402 R+ L + S T SF+ PAL ++LN Sbjct: 22 RMPLFIFCSIFTFSFYTPALDYYLN 46 >DQ080806-1|AAY89452.1| 154|Anopheles gambiae transcription factor 3C protein. Length = 154 Score = 25.4 bits (53), Expect = 1.7 Identities = 11/25 (44%), Positives = 16/25 (64%) Frame = -1 Query: 476 RLQLILSLSF*TASFFMPALKHFLN 402 R+ L + S T SF+ PAL ++LN Sbjct: 22 RMPLFIFCSIFTFSFYTPALDYYLN 46 >DQ080805-1|AAY89451.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 25.4 bits (53), Expect = 1.7 Identities = 11/25 (44%), Positives = 16/25 (64%) Frame = -1 Query: 476 RLQLILSLSF*TASFFMPALKHFLN 402 R+ L + S T SF+ PAL ++LN Sbjct: 33 RMPLFIFCSIFTFSFYTPALDYYLN 57 >DQ080804-1|AAY89450.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 25.4 bits (53), Expect = 1.7 Identities = 11/25 (44%), Positives = 16/25 (64%) Frame = -1 Query: 476 RLQLILSLSF*TASFFMPALKHFLN 402 R+ L + S T SF+ PAL ++LN Sbjct: 33 RMPLFIFCSIFTFSFYTPALDYYLN 57 >DQ080803-1|AAY89449.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 25.4 bits (53), Expect = 1.7 Identities = 11/25 (44%), Positives = 16/25 (64%) Frame = -1 Query: 476 RLQLILSLSF*TASFFMPALKHFLN 402 R+ L + S T SF+ PAL ++LN Sbjct: 33 RMPLFIFCSIFTFSFYTPALDYYLN 57 >DQ080802-1|AAY89448.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 25.4 bits (53), Expect = 1.7 Identities = 11/25 (44%), Positives = 16/25 (64%) Frame = -1 Query: 476 RLQLILSLSF*TASFFMPALKHFLN 402 R+ L + S T SF+ PAL ++LN Sbjct: 33 RMPLFIFCSIFTFSFYTPALDYYLN 57 >DQ080801-1|AAY89447.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 25.4 bits (53), Expect = 1.7 Identities = 11/25 (44%), Positives = 16/25 (64%) Frame = -1 Query: 476 RLQLILSLSF*TASFFMPALKHFLN 402 R+ L + S T SF+ PAL ++LN Sbjct: 33 RMPLFIFCSIFTFSFYTPALDYYLN 57 >DQ080800-1|AAY89446.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 25.4 bits (53), Expect = 1.7 Identities = 11/25 (44%), Positives = 16/25 (64%) Frame = -1 Query: 476 RLQLILSLSF*TASFFMPALKHFLN 402 R+ L + S T SF+ PAL ++LN Sbjct: 33 RMPLFIFCSIFTFSFYTPALDYYLN 57 >DQ080799-1|AAY89445.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 25.4 bits (53), Expect = 1.7 Identities = 11/25 (44%), Positives = 16/25 (64%) Frame = -1 Query: 476 RLQLILSLSF*TASFFMPALKHFLN 402 R+ L + S T SF+ PAL ++LN Sbjct: 33 RMPLFIFCSIFTFSFYTPALDYYLN 57 >DQ080798-1|AAY89444.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 25.4 bits (53), Expect = 1.7 Identities = 11/25 (44%), Positives = 16/25 (64%) Frame = -1 Query: 476 RLQLILSLSF*TASFFMPALKHFLN 402 R+ L + S T SF+ PAL ++LN Sbjct: 33 RMPLFIFCSIFTFSFYTPALDYYLN 57 >DQ080797-1|AAY89443.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 25.4 bits (53), Expect = 1.7 Identities = 11/25 (44%), Positives = 16/25 (64%) Frame = -1 Query: 476 RLQLILSLSF*TASFFMPALKHFLN 402 R+ L + S T SF+ PAL ++LN Sbjct: 33 RMPLFIFCSIFTFSFYTPALDYYLN 57 >DQ080796-1|AAY89442.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 25.4 bits (53), Expect = 1.7 Identities = 11/25 (44%), Positives = 16/25 (64%) Frame = -1 Query: 476 RLQLILSLSF*TASFFMPALKHFLN 402 R+ L + S T SF+ PAL ++LN Sbjct: 33 RMPLFIFCSIFTFSFYTPALDYYLN 57 >DQ080795-1|AAY89441.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 25.4 bits (53), Expect = 1.7 Identities = 11/25 (44%), Positives = 16/25 (64%) Frame = -1 Query: 476 RLQLILSLSF*TASFFMPALKHFLN 402 R+ L + S T SF+ PAL ++LN Sbjct: 33 RMPLFIFCSIFTFSFYTPALDYYLN 57 >DQ080794-1|AAY89440.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 25.4 bits (53), Expect = 1.7 Identities = 11/25 (44%), Positives = 16/25 (64%) Frame = -1 Query: 476 RLQLILSLSF*TASFFMPALKHFLN 402 R+ L + S T SF+ PAL ++LN Sbjct: 33 RMPLFIFCSIFTFSFYTPALDYYLN 57 >DQ080793-1|AAY89439.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 25.4 bits (53), Expect = 1.7 Identities = 11/25 (44%), Positives = 16/25 (64%) Frame = -1 Query: 476 RLQLILSLSF*TASFFMPALKHFLN 402 R+ L + S T SF+ PAL ++LN Sbjct: 33 RMPLFIFCSIFTFSFYTPALDYYLN 57 >DQ080792-1|AAY89438.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 25.4 bits (53), Expect = 1.7 Identities = 11/25 (44%), Positives = 16/25 (64%) Frame = -1 Query: 476 RLQLILSLSF*TASFFMPALKHFLN 402 R+ L + S T SF+ PAL ++LN Sbjct: 33 RMPLFIFCSIFTFSFYTPALDYYLN 57 >DQ080791-1|AAY89437.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 25.4 bits (53), Expect = 1.7 Identities = 11/25 (44%), Positives = 16/25 (64%) Frame = -1 Query: 476 RLQLILSLSF*TASFFMPALKHFLN 402 R+ L + S T SF+ PAL ++LN Sbjct: 33 RMPLFIFCSIFTFSFYTPALDYYLN 57 >DQ080790-1|AAY89436.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 25.4 bits (53), Expect = 1.7 Identities = 11/25 (44%), Positives = 16/25 (64%) Frame = -1 Query: 476 RLQLILSLSF*TASFFMPALKHFLN 402 R+ L + S T SF+ PAL ++LN Sbjct: 33 RMPLFIFCSIFTFSFYTPALDYYLN 57 >DQ080789-1|AAY89435.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 25.4 bits (53), Expect = 1.7 Identities = 11/25 (44%), Positives = 16/25 (64%) Frame = -1 Query: 476 RLQLILSLSF*TASFFMPALKHFLN 402 R+ L + S T SF+ PAL ++LN Sbjct: 33 RMPLFIFCSIFTFSFYTPALDYYLN 57 >DQ080788-1|AAY89434.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 25.4 bits (53), Expect = 1.7 Identities = 11/25 (44%), Positives = 16/25 (64%) Frame = -1 Query: 476 RLQLILSLSF*TASFFMPALKHFLN 402 R+ L + S T SF+ PAL ++LN Sbjct: 33 RMPLFIFCSIFTFSFYTPALDYYLN 57 >AJ302655-1|CAC35520.1| 332|Anopheles gambiae gSG5 protein protein. Length = 332 Score = 25.4 bits (53), Expect = 1.7 Identities = 15/44 (34%), Positives = 20/44 (45%) Frame = -3 Query: 435 FFHAGFEALP*STISALVPFVFVDYTVPAETACIQMVLPHAPSE 304 F FEA S+ +L P D T+C++ VLP P E Sbjct: 34 FNDGSFEASQKSSDGSLDPLDEEDIRTEQPTSCVEEVLPTDPLE 77 >AB090813-1|BAC57901.1| 724|Anopheles gambiae gag-like protein protein. Length = 724 Score = 25.4 bits (53), Expect = 1.7 Identities = 19/68 (27%), Positives = 35/68 (51%), Gaps = 1/68 (1%) Frame = +3 Query: 288 RMQRILQTEREEEPFVYMPFQQELCSRQRQKEPMQIL*IKEVLQSRHEK-RSCSKRKGQD 464 R QR+ + ERE + QQ+ +Q+Q++ Q ++ Q R ++ + ++ Q Sbjct: 175 RQQRLRRRERERQQQQQQQQQQQQQQQQQQQQQRQQQ--QQCQQQRQQQPQQQQLQQPQQ 232 Query: 465 QLQATVLR 488 QL TV+R Sbjct: 233 QLWTTVVR 240 Score = 23.4 bits (48), Expect = 6.7 Identities = 16/56 (28%), Positives = 29/56 (51%) Frame = +3 Query: 306 QTEREEEPFVYMPFQQELCSRQRQKEPMQIL*IKEVLQSRHEKRSCSKRKGQDQLQ 473 QT+ + P + QQ+ S+Q+Q++ Q L V++S +R ++ Q Q Q Sbjct: 388 QTQLQLSPRLQQQQQQQQQSQQQQQQQPQQLLWTTVVRSCPSQRQRQLQQQQQQQQ 443 Score = 23.0 bits (47), Expect = 8.9 Identities = 16/62 (25%), Positives = 30/62 (48%) Frame = +3 Query: 288 RMQRILQTEREEEPFVYMPFQQELCSRQRQKEPMQIL*IKEVLQSRHEKRSCSKRKGQDQ 467 R QR Q ++++ QQ+ +QRQ++ Q + Q + ++R +R+ Q Q Sbjct: 303 RQQRQQQQHQQQQQQQQQQRQQQQRQQQRQQQQRQ-----QQQQQQQQQRQQQQRQQQQQ 357 Query: 468 LQ 473 Q Sbjct: 358 QQ 359 Score = 23.0 bits (47), Expect = 8.9 Identities = 18/55 (32%), Positives = 29/55 (52%), Gaps = 1/55 (1%) Frame = +3 Query: 348 QQELCSRQRQKEPMQIL*IKEVLQSRHEKRSC-SKRKGQDQLQATVLRRTDAGQR 509 QQ+ +Q+Q++P Q+L V RSC S+R+ Q Q Q ++ G+R Sbjct: 403 QQQQSQQQQQQQPQQLLWTTVV-------RSCPSQRQRQLQQQQQQQQQQQQGER 450 >AY017417-1|AAG54081.1| 383|Anopheles gambiae arrestin protein. Length = 383 Score = 23.0 bits (47), Expect = 8.9 Identities = 10/24 (41%), Positives = 14/24 (58%) Frame = +3 Query: 315 REEEPFVYMPFQQELCSRQRQKEP 386 REE+ + + FQ+ELC Q P Sbjct: 65 REEDEVMGLNFQKELCLASEQIYP 88 >AJ697727-1|CAG26920.1| 285|Anopheles gambiae putative odorant-binding protein OBPjj17 protein. Length = 285 Score = 23.0 bits (47), Expect = 8.9 Identities = 15/37 (40%), Positives = 21/37 (56%) Frame = +3 Query: 408 EVLQSRHEKRSCSKRKGQDQLQATVLRRTDAGQRLSV 518 EV SR+E+ SC R G ++ T+ TD QR+ V Sbjct: 79 EVDGSRYERGSCEARCGLFKINMTM---TDRIQRVRV 112 >AJ304409-1|CAC39103.2| 383|Anopheles gambiae arrestin protein. Length = 383 Score = 23.0 bits (47), Expect = 8.9 Identities = 10/24 (41%), Positives = 14/24 (58%) Frame = +3 Query: 315 REEEPFVYMPFQQELCSRQRQKEP 386 REE+ + + FQ+ELC Q P Sbjct: 65 REEDEVMGLNFQKELCLASEQIYP 88 >AF492464-1|AAM11657.1| 803|Anopheles gambiae beta nu integrin subunit AgBnu protein. Length = 803 Score = 23.0 bits (47), Expect = 8.9 Identities = 7/20 (35%), Positives = 10/20 (50%) Frame = +1 Query: 340 CRFSRNCVVDKDKRNQCRYC 399 C F +NC+ D C +C Sbjct: 33 CFFQKNCIECLDADKDCAWC 52 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 690,846 Number of Sequences: 2352 Number of extensions: 15680 Number of successful extensions: 103 Number of sequences better than 10.0: 51 Number of HSP's better than 10.0 without gapping: 96 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 103 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 68159265 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -