BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060285.seq (674 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC3D6.02 |but2||But2 family protein But2 |Schizosaccharomyces ... 25 10.0 SPBC685.09 |orc2|orp2|origin recognition complex subunit Orc2|Sc... 25 10.0 >SPBC3D6.02 |but2||But2 family protein But2 |Schizosaccharomyces pombe|chr 2|||Manual Length = 390 Score = 25.0 bits (52), Expect = 10.0 Identities = 10/34 (29%), Positives = 16/34 (47%) Frame = +3 Query: 351 TNSQRDPQWCCEISQCTCAIRSCTQTRESAYPRS 452 T S + P E+++ C R C T+ PR+ Sbjct: 317 TTSSKGPTRLYEVARFNCTTRGCEYTQNIPCPRA 350 >SPBC685.09 |orc2|orp2|origin recognition complex subunit Orc2|Schizosaccharomyces pombe|chr 2|||Manual Length = 535 Score = 25.0 bits (52), Expect = 10.0 Identities = 11/29 (37%), Positives = 17/29 (58%) Frame = +2 Query: 545 LISTRGEFTRDRVASMRGQKLVNCXHLLG 631 +I +G +T+DR A R ++ HLLG Sbjct: 70 IIKAKGAYTKDRSAKRRRGRIEIERHLLG 98 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,452,340 Number of Sequences: 5004 Number of extensions: 44841 Number of successful extensions: 106 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 105 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 106 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 309878492 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -