BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060285.seq (674 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced prot... 71 8e-15 AB264336-1|BAF44091.1| 21|Apis mellifera ecdysone-induced prot... 44 2e-06 AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein ... 23 2.0 AB050744-1|BAB17753.1| 238|Apis mellifera period protein protein. 23 2.0 AM076717-1|CAJ28210.1| 501|Apis mellifera serotonin receptor pr... 22 4.7 AY769960-1|AAV34676.1| 603|Apis mellifera soluble guanylyl cycl... 22 6.1 AB181489-1|BAD22772.1| 603|Apis mellifera soluble guanylyl cycl... 22 6.1 >AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced protein 75 protein. Length = 900 Score = 71.3 bits (167), Expect = 8e-15 Identities = 38/52 (73%), Positives = 41/52 (78%) Frame = +1 Query: 403 VRFGRVPKREKARILAAMQQSSSSRAHEQAAAAELVTLLGCWARVVRAHLDT 558 VRFGRVPKREKARILAAMQQSS SR+ E+A AAEL A VV+AHLDT Sbjct: 138 VRFGRVPKREKARILAAMQQSSHSRSQEKAVAAELEDEQRLLATVVQAHLDT 189 >AB264336-1|BAF44091.1| 21|Apis mellifera ecdysone-induced protein 75 protein. Length = 21 Score = 43.6 bits (98), Expect = 2e-06 Identities = 18/21 (85%), Positives = 20/21 (95%) Frame = +1 Query: 337 MGEDLPILKGILNGVVKYHNA 399 MG++LPILKGILNGVV YHNA Sbjct: 1 MGDELPILKGILNGVVNYHNA 21 >AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein protein. Length = 1124 Score = 23.4 bits (48), Expect = 2.0 Identities = 12/29 (41%), Positives = 16/29 (55%), Gaps = 5/29 (17%) Frame = +1 Query: 343 EDLPILKGILNGVVK-----YHNAPVRFG 414 EDLP +K I V+K + + P RFG Sbjct: 350 EDLPFIKDIYETVIKLEGASFRSKPYRFG 378 >AB050744-1|BAB17753.1| 238|Apis mellifera period protein protein. Length = 238 Score = 23.4 bits (48), Expect = 2.0 Identities = 12/29 (41%), Positives = 16/29 (55%), Gaps = 5/29 (17%) Frame = +1 Query: 343 EDLPILKGILNGVVK-----YHNAPVRFG 414 EDLP +K I V+K + + P RFG Sbjct: 56 EDLPFIKDIYETVIKLEGASFRSKPYRFG 84 >AM076717-1|CAJ28210.1| 501|Apis mellifera serotonin receptor protein. Length = 501 Score = 22.2 bits (45), Expect = 4.7 Identities = 10/35 (28%), Positives = 20/35 (57%) Frame = +1 Query: 82 ERETLSQ*SLWCSPLTTPRCSDIRSHWIATLXFTD 186 E+ LS + SP+T+ + + +R+H +T T+ Sbjct: 319 EKPVLSSSTTTTSPMTSTKSTIVRNHLNSTCSVTN 353 >AY769960-1|AAV34676.1| 603|Apis mellifera soluble guanylyl cyclase beta 1 subunit protein. Length = 603 Score = 21.8 bits (44), Expect = 6.1 Identities = 10/31 (32%), Positives = 17/31 (54%) Frame = -3 Query: 279 NGNCNSXYIIEALGKMSHVT*DIVLNHTNTV 187 +GNC I+ + +T + +L+H NTV Sbjct: 243 SGNCKLNDILLTVRPHLELTFENILSHINTV 273 >AB181489-1|BAD22772.1| 603|Apis mellifera soluble guanylyl cyclase beta 1 subunit protein. Length = 603 Score = 21.8 bits (44), Expect = 6.1 Identities = 10/31 (32%), Positives = 17/31 (54%) Frame = -3 Query: 279 NGNCNSXYIIEALGKMSHVT*DIVLNHTNTV 187 +GNC I+ + +T + +L+H NTV Sbjct: 243 SGNCKLNDILLTVRPHLELTFENILSHINTV 273 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 169,158 Number of Sequences: 438 Number of extensions: 3126 Number of successful extensions: 12 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 20464920 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -