BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060283.seq (691 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ026038-1|AAY87897.1| 520|Apis mellifera nicotinic acetylcholi... 24 1.2 EF117814-1|ABO38437.1| 570|Apis mellifera cryptochrome 2 protein. 22 4.8 AB244761-1|BAE66603.1| 504|Apis mellifera cystathionine beta-sy... 22 4.8 DQ325067-1|ABD14081.1| 152|Apis mellifera complementary sex det... 22 6.3 DQ325066-1|ABD14080.1| 152|Apis mellifera complementary sex det... 22 6.3 DQ325065-1|ABD14079.1| 152|Apis mellifera complementary sex det... 22 6.3 DQ325064-1|ABD14078.1| 152|Apis mellifera complementary sex det... 22 6.3 DQ325063-1|ABD14077.1| 152|Apis mellifera complementary sex det... 22 6.3 DQ325062-1|ABD14076.1| 152|Apis mellifera complementary sex det... 22 6.3 DQ325061-1|ABD14075.1| 152|Apis mellifera complementary sex det... 22 6.3 AY569719-1|AAS86672.1| 401|Apis mellifera feminizer protein. 22 6.3 AY569718-1|AAS86671.1| 401|Apis mellifera feminizer protein. 22 6.3 AY569715-1|AAS86668.1| 401|Apis mellifera feminizer protein. 22 6.3 AY569714-1|AAS86667.1| 401|Apis mellifera feminizer protein. 22 6.3 AY569713-1|AAS86666.1| 401|Apis mellifera feminizer protein. 22 6.3 AY569711-1|AAS86664.1| 401|Apis mellifera feminizer protein. 22 6.3 AY352276-1|AAQ67417.1| 385|Apis mellifera complementary sex det... 22 6.3 AY350616-1|AAQ57658.1| 401|Apis mellifera complementary sex det... 22 6.3 >DQ026038-1|AAY87897.1| 520|Apis mellifera nicotinic acetylcholine receptor beta1subunit protein. Length = 520 Score = 24.2 bits (50), Expect = 1.2 Identities = 10/20 (50%), Positives = 15/20 (75%) Frame = +2 Query: 89 IGQYLIDLFKLNSIDILVTV 148 I +YL+ F +N++ ILVTV Sbjct: 296 IAKYLLFTFIMNTVSILVTV 315 >EF117814-1|ABO38437.1| 570|Apis mellifera cryptochrome 2 protein. Length = 570 Score = 22.2 bits (45), Expect = 4.8 Identities = 12/40 (30%), Positives = 16/40 (40%) Frame = +3 Query: 318 VQPLKFRYFKLFKVFFVCCSNNYAPFIIVCTNRICFNWVW 437 V PL L++ FF C + F + N IC W Sbjct: 298 VPPLSLHGQLLWREFFYCAATKNPNFDRMQGNPICVQIPW 337 >AB244761-1|BAE66603.1| 504|Apis mellifera cystathionine beta-synthase protein. Length = 504 Score = 22.2 bits (45), Expect = 4.8 Identities = 9/32 (28%), Positives = 16/32 (50%) Frame = -2 Query: 681 VRKTGREMVEEYNVDTQVLLR*SLEGERKTWW 586 +R + V EY ++T+ L+ + E WW Sbjct: 336 IRNYLTKFVSEYWMETRGFLQPVCQNEMNKWW 367 >DQ325067-1|ABD14081.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 21.8 bits (44), Expect = 6.3 Identities = 8/21 (38%), Positives = 12/21 (57%) Frame = +3 Query: 621 VIKLVYLHYIPLPFLYRSFEP 683 +I Y+ IP+P Y +F P Sbjct: 81 IIPSHYIEQIPVPVYYGNFPP 101 >DQ325066-1|ABD14080.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 21.8 bits (44), Expect = 6.3 Identities = 8/21 (38%), Positives = 12/21 (57%) Frame = +3 Query: 621 VIKLVYLHYIPLPFLYRSFEP 683 +I Y+ IP+P Y +F P Sbjct: 81 IIPSHYIEQIPVPVYYGNFPP 101 >DQ325065-1|ABD14079.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 21.8 bits (44), Expect = 6.3 Identities = 8/21 (38%), Positives = 12/21 (57%) Frame = +3 Query: 621 VIKLVYLHYIPLPFLYRSFEP 683 +I Y+ IP+P Y +F P Sbjct: 81 IIPSHYIEQIPVPVYYGNFPP 101 >DQ325064-1|ABD14078.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 21.8 bits (44), Expect = 6.3 Identities = 8/21 (38%), Positives = 12/21 (57%) Frame = +3 Query: 621 VIKLVYLHYIPLPFLYRSFEP 683 +I Y+ IP+P Y +F P Sbjct: 81 IIPSHYIEQIPVPVYYGNFPP 101 >DQ325063-1|ABD14077.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 21.8 bits (44), Expect = 6.3 Identities = 8/21 (38%), Positives = 12/21 (57%) Frame = +3 Query: 621 VIKLVYLHYIPLPFLYRSFEP 683 +I Y+ IP+P Y +F P Sbjct: 81 IIPSHYIEQIPVPVYYGNFPP 101 >DQ325062-1|ABD14076.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 21.8 bits (44), Expect = 6.3 Identities = 8/21 (38%), Positives = 12/21 (57%) Frame = +3 Query: 621 VIKLVYLHYIPLPFLYRSFEP 683 +I Y+ IP+P Y +F P Sbjct: 81 IIPSHYIEQIPVPVYYGNFPP 101 >DQ325061-1|ABD14075.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 21.8 bits (44), Expect = 6.3 Identities = 8/21 (38%), Positives = 12/21 (57%) Frame = +3 Query: 621 VIKLVYLHYIPLPFLYRSFEP 683 +I Y+ IP+P Y +F P Sbjct: 81 IIPSHYIEQIPVPVYYGNFPP 101 >AY569719-1|AAS86672.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 21.8 bits (44), Expect = 6.3 Identities = 8/21 (38%), Positives = 12/21 (57%) Frame = +3 Query: 621 VIKLVYLHYIPLPFLYRSFEP 683 +I Y+ IP+P Y +F P Sbjct: 330 IIPSHYIEQIPVPVYYGNFPP 350 >AY569718-1|AAS86671.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 21.8 bits (44), Expect = 6.3 Identities = 8/21 (38%), Positives = 12/21 (57%) Frame = +3 Query: 621 VIKLVYLHYIPLPFLYRSFEP 683 +I Y+ IP+P Y +F P Sbjct: 330 IIPSHYIEQIPVPVYYGNFPP 350 >AY569715-1|AAS86668.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 21.8 bits (44), Expect = 6.3 Identities = 8/21 (38%), Positives = 12/21 (57%) Frame = +3 Query: 621 VIKLVYLHYIPLPFLYRSFEP 683 +I Y+ IP+P Y +F P Sbjct: 330 IIPSHYIEQIPVPVYYGNFPP 350 >AY569714-1|AAS86667.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 21.8 bits (44), Expect = 6.3 Identities = 8/21 (38%), Positives = 12/21 (57%) Frame = +3 Query: 621 VIKLVYLHYIPLPFLYRSFEP 683 +I Y+ IP+P Y +F P Sbjct: 330 IIPSHYIEQIPVPVYYGNFPP 350 >AY569713-1|AAS86666.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 21.8 bits (44), Expect = 6.3 Identities = 8/21 (38%), Positives = 12/21 (57%) Frame = +3 Query: 621 VIKLVYLHYIPLPFLYRSFEP 683 +I Y+ IP+P Y +F P Sbjct: 330 IIPSHYIEQIPVPVYYGNFPP 350 >AY569711-1|AAS86664.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 21.8 bits (44), Expect = 6.3 Identities = 8/21 (38%), Positives = 12/21 (57%) Frame = +3 Query: 621 VIKLVYLHYIPLPFLYRSFEP 683 +I Y+ IP+P Y +F P Sbjct: 330 IIPSHYIEQIPVPVYYGNFPP 350 >AY352276-1|AAQ67417.1| 385|Apis mellifera complementary sex determiner protein. Length = 385 Score = 21.8 bits (44), Expect = 6.3 Identities = 8/21 (38%), Positives = 12/21 (57%) Frame = +3 Query: 621 VIKLVYLHYIPLPFLYRSFEP 683 +I Y+ IP+P Y +F P Sbjct: 314 IIPSHYIEQIPVPVYYGNFPP 334 >AY350616-1|AAQ57658.1| 401|Apis mellifera complementary sex determiner protein. Length = 401 Score = 21.8 bits (44), Expect = 6.3 Identities = 8/21 (38%), Positives = 12/21 (57%) Frame = +3 Query: 621 VIKLVYLHYIPLPFLYRSFEP 683 +I Y+ IP+P Y +F P Sbjct: 330 IIPSHYIEQIPVPVYYGNFPP 350 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 174,634 Number of Sequences: 438 Number of extensions: 3780 Number of successful extensions: 26 Number of sequences better than 10.0: 18 Number of HSP's better than 10.0 without gapping: 26 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 26 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21073995 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -