BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060279.seq (680 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY578810-1|AAT07315.1| 897|Anopheles gambiae smurf protein. 24 3.9 AY753540-1|AAV28543.1| 3320|Anopheles gambiae SGS3 protein. 24 5.1 AY753539-1|AAV28542.1| 3318|Anopheles gambiae SGS2 protein. 24 5.1 AF071163-1|AAC79999.1| 218|Anopheles gambiae glutathione S-tran... 23 8.9 AF071160-4|AAC79992.1| 218|Anopheles gambiae glutathione S-tran... 23 8.9 >AY578810-1|AAT07315.1| 897|Anopheles gambiae smurf protein. Length = 897 Score = 24.2 bits (50), Expect = 3.9 Identities = 9/21 (42%), Positives = 13/21 (61%) Frame = +2 Query: 350 QYFKDEHYSVSCQNGSVLKSK 412 QY +D+HYS+ S LK + Sbjct: 556 QYSRDDHYSLQINPDSYLKQR 576 >AY753540-1|AAV28543.1| 3320|Anopheles gambiae SGS3 protein. Length = 3320 Score = 23.8 bits (49), Expect = 5.1 Identities = 13/45 (28%), Positives = 19/45 (42%) Frame = +2 Query: 224 SYTKRYAQEQHLRDRIKSKVDEQFDQLEREYSDKIDGFHDNIQYF 358 SY K + + HL + D QL Y ++ D F I +F Sbjct: 1819 SYVKTHHGDHHLTTYMYDTNDRLVLQLPPAYHEQADTFSRTIPFF 1863 >AY753539-1|AAV28542.1| 3318|Anopheles gambiae SGS2 protein. Length = 3318 Score = 23.8 bits (49), Expect = 5.1 Identities = 13/45 (28%), Positives = 19/45 (42%) Frame = +2 Query: 224 SYTKRYAQEQHLRDRIKSKVDEQFDQLEREYSDKIDGFHDNIQYF 358 SY K + + HL + D QL Y ++ D F I +F Sbjct: 1820 SYVKTHHGDHHLTTYMYDTNDRLVLQLPPAYHEQADTFSRTIPFF 1864 >AF071163-1|AAC79999.1| 218|Anopheles gambiae glutathione S-transferase D1-3 protein. Length = 218 Score = 23.0 bits (47), Expect = 8.9 Identities = 10/43 (23%), Positives = 21/43 (48%) Frame = +2 Query: 392 GSVLKSKFAKILKSHDYTDKKSIETYEKYCLPQLVDKHNTATW 520 G L K ++K ++ + ++ ++C+P LVD+ W Sbjct: 23 GVELNLKLTDLMKG-EHMKPEFLKLNPQHCIPTLVDEDGFVLW 64 >AF071160-4|AAC79992.1| 218|Anopheles gambiae glutathione S-transferase protein. Length = 218 Score = 23.0 bits (47), Expect = 8.9 Identities = 10/43 (23%), Positives = 21/43 (48%) Frame = +2 Query: 392 GSVLKSKFAKILKSHDYTDKKSIETYEKYCLPQLVDKHNTATW 520 G L K ++K ++ + ++ ++C+P LVD+ W Sbjct: 23 GVELNLKLTDLMKG-EHMKPEFLKLNPQHCIPTLVDEDGFVLW 64 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 685,420 Number of Sequences: 2352 Number of extensions: 14269 Number of successful extensions: 21 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 19 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 21 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 68577420 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -