BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060277.seq (678 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamat... 23 2.7 AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 23 3.5 AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precurso... 22 4.7 >AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamate receptor protein. Length = 1040 Score = 23.0 bits (47), Expect = 2.7 Identities = 15/42 (35%), Positives = 21/42 (50%), Gaps = 1/42 (2%) Frame = +1 Query: 40 IFIGIK-KLLALIDMVKQTDEEYRVFKFLTKLQEEGCVDLGT 162 I I IK KL+ + K + V K LTK + GC+ G+ Sbjct: 309 ICIAIKEKLVKDSGVAKDAAYDNIVLKLLTKPRARGCIIFGS 350 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 22.6 bits (46), Expect = 3.5 Identities = 11/26 (42%), Positives = 19/26 (73%), Gaps = 1/26 (3%) Frame = -3 Query: 517 DDESTLRS-KSPVSVQVDISSSNTIS 443 D S+ RS +SP+SVQVD +++ ++ Sbjct: 448 DSSSSSRSAESPMSVQVDPMAASVVA 473 >AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precursor protein. Length = 1770 Score = 22.2 bits (45), Expect = 4.7 Identities = 12/30 (40%), Positives = 16/30 (53%) Frame = +3 Query: 312 EIDYDDVSESTDSPLDIGYHKKEMAAKRTE 401 EID DVS +P + G K ++ AK E Sbjct: 1361 EIDNLDVSLDVSNPKNAGKKKIDVRAKLNE 1390 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 167,234 Number of Sequences: 438 Number of extensions: 3637 Number of successful extensions: 4 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 20586735 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -