BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060276.seq (685 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ438610-6|CAD27478.1| 226|Anopheles gambiae hypothetical prote... 25 2.9 AF492464-1|AAM11657.1| 803|Anopheles gambiae beta nu integrin s... 24 5.1 >AJ438610-6|CAD27478.1| 226|Anopheles gambiae hypothetical protein protein. Length = 226 Score = 24.6 bits (51), Expect = 2.9 Identities = 10/24 (41%), Positives = 13/24 (54%) Frame = -2 Query: 507 FVHVKHSRCHGSFLYVTPPLCDYL 436 F+ +H GS +YV P CD L Sbjct: 29 FLLSRHKNLEGSAMYVPPLYCDSL 52 >AF492464-1|AAM11657.1| 803|Anopheles gambiae beta nu integrin subunit AgBnu protein. Length = 803 Score = 23.8 bits (49), Expect = 5.1 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +1 Query: 394 CYEDKFATRCVKCNKIITQGRRYVQERTVAPRV 492 CY C +CN +Q RR + E+ VAP V Sbjct: 494 CYVGWIGKTC-ECNLQNSQNRRELFEQCVAPSV 525 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 656,667 Number of Sequences: 2352 Number of extensions: 13046 Number of successful extensions: 22 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 22 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 22 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 68995575 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -