BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060274.seq (670 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AB090813-2|BAC57902.1| 1099|Anopheles gambiae reverse transcript... 25 2.2 AJ439060-7|CAD27758.1| 849|Anopheles gambiae putative V-ATPase ... 25 2.9 U28809-1|AAC47326.1| 140|Anopheles gambiae lysozyme protein. 24 5.0 DQ007317-1|AAY24699.1| 140|Anopheles gambiae lysozyme c-1 protein. 24 5.0 AY280611-1|AAQ21364.1| 1102|Anopheles gambiae chloride/bicarbona... 23 6.6 U03849-2|AAA53489.1| 1049|Anopheles gambiae putative reverse tra... 23 8.7 AJ439060-17|CAD27768.1| 568|Anopheles gambiae putative chitin b... 23 8.7 >AB090813-2|BAC57902.1| 1099|Anopheles gambiae reverse transcriptase protein. Length = 1099 Score = 25.0 bits (52), Expect = 2.2 Identities = 9/29 (31%), Positives = 17/29 (58%) Frame = +3 Query: 129 IYRPRSSVARTDPTVSLSKKQSAMTTQSW 215 +Y+ S+V RTD ++ K++ T + W Sbjct: 849 VYQRLSAVNRTDTRANIRKQERQATIEQW 877 >AJ439060-7|CAD27758.1| 849|Anopheles gambiae putative V-ATPase protein. Length = 849 Score = 24.6 bits (51), Expect = 2.9 Identities = 14/42 (33%), Positives = 20/42 (47%) Frame = -1 Query: 469 PQLNHQLAVCGLVFHISLKDTERWIPHQKDAHEGCFSQHGSS 344 P L ++ L+ H L+ IP+ D H+G S H SS Sbjct: 673 PSLKEDNSLLSLIGHFFLQTP---IPNNGDVHQGGDSNHTSS 711 >U28809-1|AAC47326.1| 140|Anopheles gambiae lysozyme protein. Length = 140 Score = 23.8 bits (49), Expect = 5.0 Identities = 10/22 (45%), Positives = 14/22 (63%), Gaps = 2/22 (9%) Frame = +2 Query: 596 KQIH--HHFASWLLIRNHCDGE 655 K IH H F +W +NHC+G+ Sbjct: 110 KLIHKRHGFNAWYGWKNHCNGK 131 >DQ007317-1|AAY24699.1| 140|Anopheles gambiae lysozyme c-1 protein. Length = 140 Score = 23.8 bits (49), Expect = 5.0 Identities = 10/22 (45%), Positives = 14/22 (63%), Gaps = 2/22 (9%) Frame = +2 Query: 596 KQIH--HHFASWLLIRNHCDGE 655 K IH H F +W +NHC+G+ Sbjct: 110 KLIHKRHGFNAWYGWKNHCNGK 131 >AY280611-1|AAQ21364.1| 1102|Anopheles gambiae chloride/bicarbonate anion exchanger protein. Length = 1102 Score = 23.4 bits (48), Expect = 6.6 Identities = 7/16 (43%), Positives = 11/16 (68%) Frame = -1 Query: 415 KDTERWIPHQKDAHEG 368 K+T RW+ ++D EG Sbjct: 124 KETARWVKFEEDVEEG 139 >U03849-2|AAA53489.1| 1049|Anopheles gambiae putative reverse transcriptase protein. Length = 1049 Score = 23.0 bits (47), Expect = 8.7 Identities = 9/22 (40%), Positives = 14/22 (63%) Frame = +3 Query: 117 KALMIYRPRSSVARTDPTVSLS 182 + L + +PRSS R+DP +S Sbjct: 998 ETLRLAQPRSSAGRSDPMFRMS 1019 >AJ439060-17|CAD27768.1| 568|Anopheles gambiae putative chitin binding protein protein. Length = 568 Score = 23.0 bits (47), Expect = 8.7 Identities = 15/48 (31%), Positives = 26/48 (54%), Gaps = 4/48 (8%) Frame = +1 Query: 457 DSVEGLTGNLFEVYLKPSSWRLTVRS----IVTTPSWSAGACAPSSSK 588 +++ G TG F+ +S + +S +V+TPS S+ + SSSK Sbjct: 516 NTIAGSTGERFQDLAPAASESVRSQSNNTTVVSTPSSSSSSTTSSSSK 563 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 715,390 Number of Sequences: 2352 Number of extensions: 14940 Number of successful extensions: 41 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 40 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 41 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 66904800 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -