BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060272.seq (686 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY137766-1|AAM94344.1| 78|Anopheles gambiae heat shock protein... 46 1e-06 AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. 24 3.9 AJ271193-1|CAB66001.1| 1623|Anopheles gambiae laminin gamma 1 pr... 24 3.9 U03849-2|AAA53489.1| 1049|Anopheles gambiae putative reverse tra... 24 5.2 AB090814-1|BAC57903.1| 499|Anopheles gambiae gag-like protein p... 24 5.2 AJ439060-3|CAD27754.1| 1645|Anopheles gambiae hypothetical prote... 23 9.0 AJ010299-1|CAA09070.1| 722|Anopheles gambiae stat protein. 23 9.0 AF387862-1|AAL56547.1| 476|Anopheles gambiae gag polyprotein pr... 23 9.0 >AY137766-1|AAM94344.1| 78|Anopheles gambiae heat shock protein 70 protein. Length = 78 Score = 46.0 bits (104), Expect = 1e-06 Identities = 21/24 (87%), Positives = 22/24 (91%) Frame = +1 Query: 493 NAVIHVPAYFNDSQRQATKDAGTI 564 +AVI VPAYFNDSQRQATKDAG I Sbjct: 1 DAVITVPAYFNDSQRQATKDAGAI 24 >AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. Length = 3361 Score = 24.2 bits (50), Expect = 3.9 Identities = 14/36 (38%), Positives = 20/36 (55%), Gaps = 2/36 (5%) Frame = +1 Query: 73 NGKSTRSRNRSGYHVLLRWCLPAREGGDHR--QRPG 174 +GK RS + +++LL P REG H+ Q PG Sbjct: 1802 DGKYKRSYSYEPHNLLLSNLFPPREGFHHKAVQLPG 1837 >AJ271193-1|CAB66001.1| 1623|Anopheles gambiae laminin gamma 1 precursor protein. Length = 1623 Score = 24.2 bits (50), Expect = 3.9 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = -3 Query: 588 RRNVFKPEDGTCIFCG 541 + N F EDG CI CG Sbjct: 383 KENFFMREDGYCINCG 398 >U03849-2|AAA53489.1| 1049|Anopheles gambiae putative reverse transcriptase protein. Length = 1049 Score = 23.8 bits (49), Expect = 5.2 Identities = 10/22 (45%), Positives = 13/22 (59%) Frame = +3 Query: 495 CSYSRSRVLQ*LSKTSHKRCRY 560 CSY+R R + LSK CR+ Sbjct: 445 CSYNRFRYRRYLSKIQRNLCRW 466 >AB090814-1|BAC57903.1| 499|Anopheles gambiae gag-like protein protein. Length = 499 Score = 23.8 bits (49), Expect = 5.2 Identities = 10/29 (34%), Positives = 13/29 (44%) Frame = +1 Query: 187 SVLCCVHRHRASHRRCRQEPGGENPNNTI 273 SVL C + R C P G N N ++ Sbjct: 10 SVLGCAYTQRTKCAACLDSPDGMNGNESL 38 >AJ439060-3|CAD27754.1| 1645|Anopheles gambiae hypothetical protein protein. Length = 1645 Score = 23.0 bits (47), Expect = 9.0 Identities = 9/37 (24%), Positives = 18/37 (48%) Frame = +3 Query: 171 RATGPLRLMLRSQTPSVSSEMPPRTRWREPQQHNIRC 281 + G L + S + +VSS++PP + ++ C Sbjct: 744 KVAGTLGAVQPSSSEAVSSKLPPTAEPEHSESSDVEC 780 >AJ010299-1|CAA09070.1| 722|Anopheles gambiae stat protein. Length = 722 Score = 23.0 bits (47), Expect = 9.0 Identities = 9/32 (28%), Positives = 17/32 (53%) Frame = +1 Query: 472 YLGKTVQNAVIHVPAYFNDSQRQATKDAGTIF 567 +LG +++++ + P Y N+ Q DA F Sbjct: 31 HLGNWIKDSLHNAPTYTNNMQSMYELDAAKFF 62 >AF387862-1|AAL56547.1| 476|Anopheles gambiae gag polyprotein protein. Length = 476 Score = 23.0 bits (47), Expect = 9.0 Identities = 18/81 (22%), Positives = 34/81 (41%), Gaps = 1/81 (1%) Frame = +3 Query: 96 ESIWVPRTLALVSSSTGRWRSSPT-TRATGPLRLMLRSQTPSVSSEMPPRTRWREPQQHN 272 E++W + A S T W+ RAT L L+ Q P + + W Q+H+ Sbjct: 30 ENLWKFESTAAPESLTETWKEGDAKARATIAL-LVDDCQHPLIRDCKTAKGTWDALQKHH 88 Query: 273 IRCQTSHRT*VRRCYCASRHE 335 + S + + + C + ++ Sbjct: 89 QKTTMSTKVSLLKKLCKAEYD 109 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 800,152 Number of Sequences: 2352 Number of extensions: 17724 Number of successful extensions: 27 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 26 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 27 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 69413730 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -