BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060268.seq (656 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 11_01_0749 - 6305087-6307522 30 1.4 10_08_0209 + 15869966-15870024,15870050-15870138,15870963-15872359 30 1.9 >11_01_0749 - 6305087-6307522 Length = 811 Score = 30.3 bits (65), Expect = 1.4 Identities = 12/32 (37%), Positives = 18/32 (56%) Frame = +2 Query: 179 GWGNRCNYTEPLELISQGGWRICVVVSMGSSH 274 G R P++ +S GG+R+C V+S G H Sbjct: 131 GRSKRVYLGPPIQALSSGGYRVCGVLSSGELH 162 >10_08_0209 + 15869966-15870024,15870050-15870138,15870963-15872359 Length = 514 Score = 29.9 bits (64), Expect = 1.9 Identities = 12/25 (48%), Positives = 14/25 (56%) Frame = -3 Query: 120 PCVRTRGPATTSKIPVTSKIQMCHI 46 PC RGPA + +TS Q CHI Sbjct: 38 PCTLPRGPANLGMLRMTSDQQRCHI 62 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,946,185 Number of Sequences: 37544 Number of extensions: 349874 Number of successful extensions: 510 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 500 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 510 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1644004708 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -