BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060268.seq (656 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_19291| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.4 SB_52216| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.8 >SB_19291| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1258 Score = 28.7 bits (61), Expect = 4.4 Identities = 12/20 (60%), Positives = 14/20 (70%) Frame = -3 Query: 177 SSRNALLLHGKNRQGGGTYP 118 SS N+ L KNR+G GTYP Sbjct: 724 SSDNSFSLEDKNREGPGTYP 743 >SB_52216| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 979 Score = 28.3 bits (60), Expect = 5.8 Identities = 15/33 (45%), Positives = 16/33 (48%) Frame = -1 Query: 188 CPTLQAETHYCFTAKIGRAVVPTRAYVQEVLLP 90 CPT T YC TA + A PT AY Q P Sbjct: 945 CPTANRPTAYCPTAYLPTAYCPT-AYRQTAFCP 976 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,736,487 Number of Sequences: 59808 Number of extensions: 394597 Number of successful extensions: 639 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 575 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 636 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1681430875 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -