BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060266.seq (655 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY337337-1|AAP94192.1| 505|Tribolium castaneum cytochrome P450 ... 26 0.31 AF254755-1|AAF70496.1| 505|Tribolium castaneum cytochrome P450 ... 26 0.31 AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory recept... 22 5.1 >AY337337-1|AAP94192.1| 505|Tribolium castaneum cytochrome P450 monooxygenase protein. Length = 505 Score = 25.8 bits (54), Expect = 0.31 Identities = 16/53 (30%), Positives = 27/53 (50%), Gaps = 5/53 (9%) Frame = +2 Query: 188 CGQVNKCI*IQATMSYIEPNASKCVEEYKKSV-DSAEENMKD----ELDELNT 331 C ++KCI + Y+E ++ + + KSV +EN K+ E DE+ T Sbjct: 224 CWLISKCIYVFNPRYYLEKKVTRRLHRFTKSVIAERQENFKEIVVPETDEVYT 276 >AF254755-1|AAF70496.1| 505|Tribolium castaneum cytochrome P450 monooxigenase CYP4Q7 protein. Length = 505 Score = 25.8 bits (54), Expect = 0.31 Identities = 16/53 (30%), Positives = 27/53 (50%), Gaps = 5/53 (9%) Frame = +2 Query: 188 CGQVNKCI*IQATMSYIEPNASKCVEEYKKSV-DSAEENMKD----ELDELNT 331 C ++KCI + Y+E ++ + + KSV +EN K+ E DE+ T Sbjct: 224 CWLISKCIYVFNPRYYLEKKVTRRLHRFTKSVIAERQENFKEIVVPETDEVYT 276 >AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory receptor candidate 46 protein. Length = 1451 Score = 21.8 bits (44), Expect = 5.1 Identities = 10/25 (40%), Positives = 14/25 (56%) Frame = -1 Query: 241 FDVRHCCLNSYAFINLSTQFKHINV 167 F+V HC L S + L +F +NV Sbjct: 533 FNVVHCYLASELVLMLKNRFVTLNV 557 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 139,942 Number of Sequences: 336 Number of extensions: 2853 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 16865010 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -