BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060266.seq (655 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY939827-1|AAY18208.1| 680|Anopheles gambiae CTCF-like protein ... 23 6.4 AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. 23 8.4 >AY939827-1|AAY18208.1| 680|Anopheles gambiae CTCF-like protein protein. Length = 680 Score = 23.4 bits (48), Expect = 6.4 Identities = 16/45 (35%), Positives = 23/45 (51%) Frame = +2 Query: 263 EEYKKSVDSAEENMKDELDELNTKQENGILYQYELPIEQDSDGQW 397 EE + D EE+ +DE DEL G L ++ +D DGQ+ Sbjct: 487 EEDEYEGDDTEEDEEDEDDELAA----GPLGTSDVVTVEDGDGQY 527 >AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. Length = 3361 Score = 23.0 bits (47), Expect = 8.4 Identities = 12/33 (36%), Positives = 18/33 (54%) Frame = +3 Query: 57 ESGEAVSLFDLDENDQQFSEKYKFCCSIEINED 155 ++GE V++ E F+E KF S EIN + Sbjct: 867 QNGEWVTVKAAPEKVNYFNEIDKFISSFEINSE 899 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 596,868 Number of Sequences: 2352 Number of extensions: 10648 Number of successful extensions: 19 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 18 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 19 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 64814025 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -