BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060266.seq (655 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g14900.1 68417.m02288 hydroxyproline-rich glycoprotein family... 32 0.38 At3g22440.1 68416.m02836 hydroxyproline-rich glycoprotein family... 32 0.38 At2g15090.1 68415.m01720 fatty acid elongase, putative similar ... 29 2.7 At4g15475.1 68417.m02365 F-box family protein (FBL4) 99.7% ident... 29 3.6 At4g02800.1 68417.m00380 expressed protein similar to A. thalian... 29 3.6 At1g04650.1 68414.m00462 hypothetical protein 29 3.6 At5g42880.1 68418.m05226 hypothetical protein contains Pfam prof... 28 4.7 At1g06910.1 68414.m00734 myb family transcription factor contain... 28 4.7 At4g03350.1 68417.m00457 ubiquitin family protein contains INTER... 28 6.2 At5g39970.1 68418.m04847 expressed protein low similarity to up-... 27 8.2 At5g19840.1 68418.m02357 transcription factor jumonji (jmjC) dom... 27 8.2 >At4g14900.1 68417.m02288 hydroxyproline-rich glycoprotein family protein Length = 532 Score = 31.9 bits (69), Expect = 0.38 Identities = 15/30 (50%), Positives = 19/30 (63%), Gaps = 1/30 (3%) Frame = +2 Query: 254 KCVEEYKKSVDSAEENMKDELDEL-NTKQE 340 KC+EEYK + EN+K LD+L TK E Sbjct: 377 KCIEEYKLEEEFPPENLKKRLDQLEKTKTE 406 >At3g22440.1 68416.m02836 hydroxyproline-rich glycoprotein family protein identical to hydroxyproline-rich glycoprotein [Arabidopsis thaliana] gi|9293881|dbj|BAB01784 Length = 532 Score = 31.9 bits (69), Expect = 0.38 Identities = 15/30 (50%), Positives = 19/30 (63%), Gaps = 1/30 (3%) Frame = +2 Query: 254 KCVEEYKKSVDSAEENMKDELDEL-NTKQE 340 KC+EEYK + EN+K LD+L TK E Sbjct: 379 KCIEEYKLEEEFPPENLKKRLDQLEKTKTE 408 >At2g15090.1 68415.m01720 fatty acid elongase, putative similar to fatty acid elongase 1 [GI:881615] Length = 481 Score = 29.1 bits (62), Expect = 2.7 Identities = 17/38 (44%), Positives = 21/38 (55%) Frame = +3 Query: 480 ILMNKDKLMFTRISGKKPKPHNPDLRQYNYDSKRLFEH 593 +L K+KL F I+ K K P+LR Y D K FEH Sbjct: 340 VLPLKEKLAFF-ITFVKKKYFKPELRNYTPDFKLAFEH 376 >At4g15475.1 68417.m02365 F-box family protein (FBL4) 99.7% identical to F-box protein family, AtFBL4 (GP:21536497) [Arabidopsis thaliana]; similar to grr1 GI:2407790 from [Glycine max] Length = 610 Score = 28.7 bits (61), Expect = 3.6 Identities = 10/24 (41%), Positives = 17/24 (70%) Frame = -3 Query: 416 SSLVSESTGHHCPVLSVVHIDTEY 345 + L E+ G HC +L V+++D+EY Sbjct: 232 TDLSLEAVGSHCKLLEVLYLDSEY 255 >At4g02800.1 68417.m00380 expressed protein similar to A. thaliana hypothetical protein T6B20.12 (1946366) Length = 333 Score = 28.7 bits (61), Expect = 3.6 Identities = 12/35 (34%), Positives = 21/35 (60%) Frame = -3 Query: 452 DPRLWSQLNYWESSLVSESTGHHCPVLSVVHIDTE 348 D RLWS + L+ E++ +H PV + + I++E Sbjct: 40 DKRLWSNVRNRVDVLLEENSKNHKPVTNTIAIESE 74 >At1g04650.1 68414.m00462 hypothetical protein Length = 936 Score = 28.7 bits (61), Expect = 3.6 Identities = 13/41 (31%), Positives = 22/41 (53%) Frame = -1 Query: 202 INLSTQFKHINVGNRSSSLISMLQQNLYFSLNCWSFSSKSN 80 ++ T ++VG LIS+++ +L F+ WS S K N Sbjct: 223 LDKQTLVSKVDVGEIILKLISLIKDSLRFAAEAWSCSVKEN 263 >At5g42880.1 68418.m05226 hypothetical protein contains Pfam profile PF05701: Plant protein of unknown function (DUF827) Length = 751 Score = 28.3 bits (60), Expect = 4.7 Identities = 16/43 (37%), Positives = 27/43 (62%), Gaps = 1/43 (2%) Frame = +2 Query: 254 KCVEEYKKSVDSAEENMKDELDEL-NTKQENGILYQYELPIEQ 379 + + EYK+ + AEE D L+EL NTK G++ + +L +E+ Sbjct: 179 EAMPEYKREAELAEEAKYDALEELENTK---GLIEELKLELEK 218 >At1g06910.1 68414.m00734 myb family transcription factor contains Pfam profile: PF00249 myb-like DNA-binding domain Length = 390 Score = 28.3 bits (60), Expect = 4.7 Identities = 17/73 (23%), Positives = 37/73 (50%) Frame = +2 Query: 230 SYIEPNASKCVEEYKKSVDSAEENMKDELDELNTKQENGILYQYELPIEQDSDGQWTRTL 409 S +EP ++ E+ S+D ++ M D+++ +N + I+ P++++ + R Sbjct: 278 SLMEPRSTAHTYEWNDSIDDSDGEMGDDIERINKSKRKRIVVS---PLKRNRCSEGARR- 333 Query: 410 VKTPSSSVVTKAL 448 K P S+ T A+ Sbjct: 334 PKLPWSTAETLAV 346 >At4g03350.1 68417.m00457 ubiquitin family protein contains INTERPRO:IPR000626 ubiquitin domain Length = 263 Score = 27.9 bits (59), Expect = 6.2 Identities = 19/59 (32%), Positives = 26/59 (44%) Frame = +2 Query: 227 MSYIEPNASKCVEEYKKSVDSAEENMKDELDELNTKQENGILYQYELPIEQDSDGQWTR 403 M +E NA VEE +K + +E ELN E L ELP+ + +W R Sbjct: 197 MIQVEVNADDNVEELRKELVKMQER-----GELNLPHEAFHLVSSELPLIETKSFKWNR 250 >At5g39970.1 68418.m04847 expressed protein low similarity to up-regulated by thyroid hormone in tadpoles; expressed specifically in the tail and only at metamorphosis; membrane bound or extracellular protein; C-terminal basic region [Xenopus laevis] GI:1234787 Length = 690 Score = 27.5 bits (58), Expect = 8.2 Identities = 13/30 (43%), Positives = 15/30 (50%) Frame = -1 Query: 223 CLNSYAFINLSTQFKHINVGNRSSSLISML 134 C NS + L QFK NV R S L+ L Sbjct: 51 CCNSLEDLKLQRQFKAFNVSGRCSPLLKSL 80 >At5g19840.1 68418.m02357 transcription factor jumonji (jmjC) domain-containing protein low similarity to PASS1 [Homo sapiens] GI:21591407; contains Pfam profile PF02373: jmjC domain Length = 505 Score = 27.5 bits (58), Expect = 8.2 Identities = 10/28 (35%), Positives = 18/28 (64%) Frame = -3 Query: 461 SFLDPRLWSQLNYWESSLVSESTGHHCP 378 +FLD + S +N+W +S + S+ H+ P Sbjct: 160 TFLDAKSLSSINFWMNSAEARSSTHYDP 187 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,604,377 Number of Sequences: 28952 Number of extensions: 240274 Number of successful extensions: 756 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 731 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 756 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1363910256 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -