BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060264.seq (686 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_A5K729 Cluster: Putative uncharacterized protein; n=1; ... 33 4.9 >UniRef50_A5K729 Cluster: Putative uncharacterized protein; n=1; Plasmodium vivax|Rep: Putative uncharacterized protein - Plasmodium vivax Length = 4216 Score = 33.5 bits (73), Expect = 4.9 Identities = 20/70 (28%), Positives = 32/70 (45%), Gaps = 6/70 (8%) Frame = +2 Query: 473 GYSNTVLFDAGIT----LAGILHSLKVCLR*SPSYNSLQSSMSCSTYRKVYPIGRRKLSC 640 G S T+L D+ + + +H +K ++ + YN +S + + VY G K C Sbjct: 3223 GKSETILLDSNLNNNKFIYNFIHDIKSRVKFTDIYNGADFVISINNFGHVYSWGNNKYGC 3282 Query: 641 --TGDPKNNY 664 TGD N Y Sbjct: 3283 LGTGDKINRY 3292 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 614,326,779 Number of Sequences: 1657284 Number of extensions: 11219816 Number of successful extensions: 20401 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 19880 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 20399 length of database: 575,637,011 effective HSP length: 98 effective length of database: 413,223,179 effective search space used: 53719013270 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -