BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060264.seq (686 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY618898-1|AAU87291.1| 803|Tribolium castaneum receptor tyrosin... 25 0.77 AM292369-1|CAL23181.1| 408|Tribolium castaneum gustatory recept... 24 1.0 >AY618898-1|AAU87291.1| 803|Tribolium castaneum receptor tyrosine kinase Torso-likeprotein protein. Length = 803 Score = 24.6 bits (51), Expect = 0.77 Identities = 10/23 (43%), Positives = 14/23 (60%) Frame = -1 Query: 224 SE*LRMFDDRISVDLQIRQHTYI 156 SE +R F I++ +RQH YI Sbjct: 491 SEEIRQFTQEINIMKSVRQHPYI 513 >AM292369-1|CAL23181.1| 408|Tribolium castaneum gustatory receptor candidate 48 protein. Length = 408 Score = 24.2 bits (50), Expect = 1.0 Identities = 13/38 (34%), Positives = 17/38 (44%) Frame = -1 Query: 473 HFFQTNCSIFR*FVL*DLFYAVLNRVLVFIIKINDSVY 360 HFF CSI +L D+ + V + F IN Y Sbjct: 347 HFFSVKCSIQSESLLNDILFPVAGFISDFDCDINSIQY 384 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 150,463 Number of Sequences: 336 Number of extensions: 3032 Number of successful extensions: 6 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 18010165 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -