Bombyx BLAST Result against bee

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV060264.seq
         (686 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY398690-1|AAR83734.1|  416|Apis mellifera major royal jelly pro...    27   0.22 
DQ000307-1|AAY21180.1|  423|Apis mellifera major royal jelly pro...    25   0.68 

>AY398690-1|AAR83734.1|  416|Apis mellifera major royal jelly
           protein 8 protein.
          Length = 416

 Score = 26.6 bits (56), Expect = 0.22
 Identities = 10/13 (76%), Positives = 11/13 (84%)
 Frame = +1

Query: 424 SHNTNYLNIEQFV 462
           SHN NY+N EQFV
Sbjct: 270 SHNLNYVNTEQFV 282


>DQ000307-1|AAY21180.1|  423|Apis mellifera major royal jelly
           protein 9 protein.
          Length = 423

 Score = 25.0 bits (52), Expect = 0.68
 Identities = 14/36 (38%), Positives = 20/36 (55%)
 Frame = +1

Query: 367 LSLILIIKTKTRLRTA*NKSHNTNYLNIEQFVWKKW 474
           L + L  KT+    +A   SHN NY+N +QF   K+
Sbjct: 251 LGMALSHKTQNLYYSA-MSSHNLNYVNTKQFTQGKF 285


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 180,573
Number of Sequences: 438
Number of extensions: 3907
Number of successful extensions: 2
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2
length of database: 146,343
effective HSP length: 56
effective length of database: 121,815
effective search space used: 20952180
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)