BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060261.seq (685 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ010903-1|CAA09389.1| 373|Anopheles gambiae ICHIT protein prot... 27 0.73 AJ439353-7|CAD27929.1| 555|Anopheles gambiae putative glycerol ... 23 6.8 >AJ010903-1|CAA09389.1| 373|Anopheles gambiae ICHIT protein protein. Length = 373 Score = 26.6 bits (56), Expect = 0.73 Identities = 9/32 (28%), Positives = 17/32 (53%) Frame = +3 Query: 309 SCTALRAAGPSHFLXPKKXGKWNAMHVRIAWE 404 +C ++ P +F+ P ++ H+R AWE Sbjct: 33 NCPEMQGPLPHYFIHPTNCSRFYECHMRDAWE 64 >AJ439353-7|CAD27929.1| 555|Anopheles gambiae putative glycerol kinase protein. Length = 555 Score = 23.4 bits (48), Expect = 6.8 Identities = 8/16 (50%), Positives = 12/16 (75%) Frame = +1 Query: 373 GTRCM*ESHGRYTTIS 420 GTRC+ +HG TT++ Sbjct: 289 GTRCVQSTHGLVTTVA 304 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 529,285 Number of Sequences: 2352 Number of extensions: 8381 Number of successful extensions: 22 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 20 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 22 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 68995575 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -