BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060261.seq (685 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF125964-1|AAD14753.1| 471|Caenorhabditis elegans Hypothetical ... 29 3.1 Z67756-3|CAA91764.3| 377|Caenorhabditis elegans Hypothetical pr... 27 9.4 >AF125964-1|AAD14753.1| 471|Caenorhabditis elegans Hypothetical protein W03G1.5 protein. Length = 471 Score = 29.1 bits (62), Expect = 3.1 Identities = 20/41 (48%), Positives = 21/41 (51%) Frame = +3 Query: 561 SPLRFRGHXPTGRHWFRSIWPMGRRAGTGRHPXHGVQSRRP 683 SP RGH GRH RS P GR G G H HG +S P Sbjct: 231 SPGGRRGHG--GRHGSRSGSPGGRH-GHGGHGGHGSRSGSP 268 >Z67756-3|CAA91764.3| 377|Caenorhabditis elegans Hypothetical protein R07A4.4 protein. Length = 377 Score = 27.5 bits (58), Expect = 9.4 Identities = 12/34 (35%), Positives = 20/34 (58%), Gaps = 2/34 (5%) Frame = +1 Query: 466 DRYRRLPXRI--GHRMTALSVFATSSATLECLRS 561 D +RR+P I GH +SV + + LEC+++ Sbjct: 135 DVFRRIPQHILLGHASEVISVASENECVLECIKA 168 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,434,009 Number of Sequences: 27780 Number of extensions: 186630 Number of successful extensions: 364 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 361 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 364 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1560745544 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -