BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060260.seq (654 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g06350.1 68418.m00711 expressed protein 29 2.7 At4g04920.1 68417.m00715 expressed protein 28 6.2 >At5g06350.1 68418.m00711 expressed protein Length = 890 Score = 29.1 bits (62), Expect = 2.7 Identities = 11/19 (57%), Positives = 14/19 (73%) Frame = +2 Query: 134 IVNIIPEETKNKYAYIKHC 190 IVN IPE+ +N Y YI+ C Sbjct: 751 IVNCIPEDKENSYLYIQTC 769 >At4g04920.1 68417.m00715 expressed protein Length = 1250 Score = 27.9 bits (59), Expect = 6.2 Identities = 17/48 (35%), Positives = 23/48 (47%), Gaps = 2/48 (4%) Frame = -3 Query: 358 PDAGTPRLCSSPAR--SSWLSRRRQTDRRLAVCSNSQVAL*CYLVHIG 221 PD +C R S W +RR ++R A SN+ V L YL +G Sbjct: 1163 PDTNFSGICDGYNRVHSLWPRKRRMSERDAAFGSNTSVGLGAYLGIMG 1210 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,811,664 Number of Sequences: 28952 Number of extensions: 247049 Number of successful extensions: 651 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 557 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 651 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1363910256 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -