SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV060257.seq
         (688 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AF487537-1|AAL93298.1|  507|Anopheles gambiae cytochrome P450 CY...    27   0.73 

>AF487537-1|AAL93298.1|  507|Anopheles gambiae cytochrome P450
           CYP6P2 protein.
          Length = 507

 Score = 26.6 bits (56), Expect = 0.73
 Identities = 18/63 (28%), Positives = 25/63 (39%), Gaps = 1/63 (1%)
 Frame = +2

Query: 68  MAQQEISCGYEYIITADLQTCLTEALQCSYSFIVSPIIHPRFRRQSTNA-GKNGGFTRSD 244
           M   E++        A  +T  T    C Y     P I  R RR+   A  +NGG    D
Sbjct: 297 MTMNELAAQVFIFFLAGFETSSTTMNFCLYELAKHPDIQERLRREIERAVEENGGELTYD 356

Query: 245 MVL 253
           +V+
Sbjct: 357 VVM 359


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 790,503
Number of Sequences: 2352
Number of extensions: 17413
Number of successful extensions: 26
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 26
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 26
length of database: 563,979
effective HSP length: 62
effective length of database: 418,155
effective search space used: 69413730
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -