BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060257.seq (688 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF487537-1|AAL93298.1| 507|Anopheles gambiae cytochrome P450 CY... 27 0.73 >AF487537-1|AAL93298.1| 507|Anopheles gambiae cytochrome P450 CYP6P2 protein. Length = 507 Score = 26.6 bits (56), Expect = 0.73 Identities = 18/63 (28%), Positives = 25/63 (39%), Gaps = 1/63 (1%) Frame = +2 Query: 68 MAQQEISCGYEYIITADLQTCLTEALQCSYSFIVSPIIHPRFRRQSTNA-GKNGGFTRSD 244 M E++ A +T T C Y P I R RR+ A +NGG D Sbjct: 297 MTMNELAAQVFIFFLAGFETSSTTMNFCLYELAKHPDIQERLRREIERAVEENGGELTYD 356 Query: 245 MVL 253 +V+ Sbjct: 357 VVM 359 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 790,503 Number of Sequences: 2352 Number of extensions: 17413 Number of successful extensions: 26 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 26 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 26 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 69413730 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -