BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060256.seq (672 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AJ850288-1|CAH64508.1| 510|Tribolium castaneum putative esteras... 23 3.0 EF633444-1|ABR32189.1| 721|Tribolium castaneum heat shock prote... 22 4.0 AJ850287-1|CAH64507.1| 509|Tribolium castaneum putative esteras... 21 9.2 >AJ850288-1|CAH64508.1| 510|Tribolium castaneum putative esterase protein. Length = 510 Score = 22.6 bits (46), Expect = 3.0 Identities = 11/30 (36%), Positives = 14/30 (46%) Frame = +3 Query: 372 VKLWQAVIKKGDLNMKNLRTRLQLQINP*T 461 VKLW + K GD N K + + P T Sbjct: 465 VKLWTSFAKNGDPNPKEKTPLINVTWKPVT 494 >EF633444-1|ABR32189.1| 721|Tribolium castaneum heat shock protein 90 protein. Length = 721 Score = 22.2 bits (45), Expect = 4.0 Identities = 8/14 (57%), Positives = 12/14 (85%) Frame = +2 Query: 479 EDSKNRKKLKQMLK 520 EDS+NR KL ++L+ Sbjct: 440 EDSQNRAKLSELLR 453 >AJ850287-1|CAH64507.1| 509|Tribolium castaneum putative esterase protein. Length = 509 Score = 21.0 bits (42), Expect = 9.2 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +3 Query: 372 VKLWQAVIKKGDLNMK 419 VKLW K GD N K Sbjct: 464 VKLWTNFAKNGDPNPK 479 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 129,311 Number of Sequences: 336 Number of extensions: 2445 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 17489640 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -