BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060252.seq (685 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ459779-1|CAD30839.1| 405|Anopheles gambiae clip-domain serine... 23 9.0 AF007166-1|AAB62929.1| 360|Anopheles gambiae serine protease 14... 23 9.0 >AJ459779-1|CAD30839.1| 405|Anopheles gambiae clip-domain serine protease protein. Length = 405 Score = 23.0 bits (47), Expect = 9.0 Identities = 9/31 (29%), Positives = 16/31 (51%) Frame = +2 Query: 383 CARMKVPRLVEISSGQMCSNDKPQKEDCSID 475 C++ P + GQMC+ + K+ C+ D Sbjct: 322 CSKTFRPWSFALGPGQMCAGGERAKDTCAGD 352 >AF007166-1|AAB62929.1| 360|Anopheles gambiae serine protease 14D protein. Length = 360 Score = 23.0 bits (47), Expect = 9.0 Identities = 12/41 (29%), Positives = 20/41 (48%) Frame = +2 Query: 353 VTLSLNVAKHCARMKVPRLVEISSGQMCSNDKPQKEDCSID 475 V L++ K C+ + + + S QMC+ K+ CS D Sbjct: 270 VELTVVDVKDCSPVYQRNGISLDSTQMCAGGVRGKDTCSGD 310 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 759,377 Number of Sequences: 2352 Number of extensions: 15362 Number of successful extensions: 30 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 30 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 30 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 68995575 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -