BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060252.seq (685 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC004929-1|AAH04929.1| 369|Homo sapiens hydroxy-delta-5-steroid... 30 6.7 AK057436-1|BAB71486.1| 196|Homo sapiens protein ( Homo sapiens ... 30 6.7 AF277719-1|AAG37824.1| 369|Homo sapiens 3 beta-hydroxy-delta 5-... 30 6.7 >BC004929-1|AAH04929.1| 369|Homo sapiens hydroxy-delta-5-steroid dehydrogenase, 3 beta- and steroid delta-isomerase 7 protein. Length = 369 Score = 30.3 bits (65), Expect = 6.7 Identities = 14/32 (43%), Positives = 21/32 (65%), Gaps = 1/32 (3%) Frame = +3 Query: 54 LILGGCGFIGRNLVDYLI-RNDLVSGLRVVDK 146 L+ GGCGF+G ++V L+ R + LRV D+ Sbjct: 13 LVTGGCGFLGEHVVRMLLQREPRLGELRVFDQ 44 >AK057436-1|BAB71486.1| 196|Homo sapiens protein ( Homo sapiens cDNA FLJ32874 fis, clone TESTI2004000, highly similar to Rattus norvegicus cca2 mRNA. ). Length = 196 Score = 30.3 bits (65), Expect = 6.7 Identities = 14/32 (43%), Positives = 21/32 (65%), Gaps = 1/32 (3%) Frame = +3 Query: 54 LILGGCGFIGRNLVDYLI-RNDLVSGLRVVDK 146 L+ GGCGF+G ++V L+ R + LRV D+ Sbjct: 13 LVTGGCGFLGEHVVRMLLQREPRLGELRVFDQ 44 >AF277719-1|AAG37824.1| 369|Homo sapiens 3 beta-hydroxy-delta 5-C27-steroid oxidoreductase protein. Length = 369 Score = 30.3 bits (65), Expect = 6.7 Identities = 14/32 (43%), Positives = 21/32 (65%), Gaps = 1/32 (3%) Frame = +3 Query: 54 LILGGCGFIGRNLVDYLI-RNDLVSGLRVVDK 146 L+ GGCGF+G ++V L+ R + LRV D+ Sbjct: 13 LVTGGCGFLGEHVVRMLLQREPRLGELRVFDQ 44 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 109,169,453 Number of Sequences: 237096 Number of extensions: 2474519 Number of successful extensions: 5243 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 5005 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5239 length of database: 76,859,062 effective HSP length: 88 effective length of database: 55,994,614 effective search space used: 7783251346 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -