BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060251.seq (687 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_29972| Best HMM Match : zf-CCHC (HMM E-Value=9.3e-05) 29 3.5 SB_812| Best HMM Match : FH2 (HMM E-Value=0) 29 4.7 >SB_29972| Best HMM Match : zf-CCHC (HMM E-Value=9.3e-05) Length = 285 Score = 29.1 bits (62), Expect = 3.5 Identities = 15/59 (25%), Positives = 32/59 (54%), Gaps = 1/59 (1%) Frame = -3 Query: 202 AKSAISSRGIRTQ-GQRFGKRLTRTSSRTKQRHITTECGNMTGAMCSACVLGWVTTHDV 29 A++ I R + Q Q+ G+R+ S K+ +T E G + ++ C++G V ++++ Sbjct: 64 ARNVIYERLVFNQRNQKEGERMDNFVSELKRLSLTCEFGTLRDSLIRDCIVGGVLSNEL 122 >SB_812| Best HMM Match : FH2 (HMM E-Value=0) Length = 1430 Score = 28.7 bits (61), Expect = 4.7 Identities = 19/67 (28%), Positives = 30/67 (44%), Gaps = 1/67 (1%) Frame = +2 Query: 338 CREAVIGVVGSAEETVASIRSSTAYTTRHANALRGKRSHTGPLRQTRPVH-ISTYRRSRC 514 CR+ V+ V S RS+T+ TT + + + HT P +H + ++ C Sbjct: 7 CRDRVLCVFRSYMRHQTKTRSTTSQTTWRSWTWKTQSRHTHPTPAILCLHMLVLIKKGVC 66 Query: 515 EVPRRTS 535 P RTS Sbjct: 67 SKPLRTS 73 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,023,042 Number of Sequences: 59808 Number of extensions: 377452 Number of successful extensions: 1102 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 977 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1101 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1781448916 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -