BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060251.seq (687 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC033256-1|AAH33256.1| 319|Homo sapiens FAM83H protein protein. 31 5.1 AK127960-1|BAC87207.1| 886|Homo sapiens protein ( Homo sapiens ... 31 5.1 AK127541-1|BAC87026.1| 733|Homo sapiens protein ( Homo sapiens ... 30 6.7 AB109390-1|BAF02295.1| 531|Homo sapiens Serase-1B protein. 30 6.7 >BC033256-1|AAH33256.1| 319|Homo sapiens FAM83H protein protein. Length = 319 Score = 30.7 bits (66), Expect = 5.1 Identities = 20/62 (32%), Positives = 27/62 (43%) Frame = +3 Query: 369 LPKRPSRRSAPVPPIPRAMRMLYEASGAIPGRCGKHGPFISARTDGADARFPGEHRFSPI 548 +P P RRS+PVPP+P L + I G K GP + + G R + Sbjct: 56 VPPVPERRSSPVPPVPERRGSL---TLTISGESPKAGPAEEGPSGPMEVLRKGSLRLRQL 112 Query: 549 LS 554 LS Sbjct: 113 LS 114 >AK127960-1|BAC87207.1| 886|Homo sapiens protein ( Homo sapiens cDNA FLJ46072 fis, clone TESTI1000459. ). Length = 886 Score = 30.7 bits (66), Expect = 5.1 Identities = 20/62 (32%), Positives = 27/62 (43%) Frame = +3 Query: 369 LPKRPSRRSAPVPPIPRAMRMLYEASGAIPGRCGKHGPFISARTDGADARFPGEHRFSPI 548 +P P RRS+PVPP+P L + I G K GP + + G R + Sbjct: 623 VPPVPERRSSPVPPVPERRGSL---TLTISGESPKAGPAEEGPSGPMEVLRKGSLRLRQL 679 Query: 549 LS 554 LS Sbjct: 680 LS 681 >AK127541-1|BAC87026.1| 733|Homo sapiens protein ( Homo sapiens cDNA FLJ45634 fis, clone CHONS2002829, moderately similar to Homo sapiens adipocyte enhancer binding protein 1 (AEBP1). ). Length = 733 Score = 30.3 bits (65), Expect = 6.7 Identities = 10/24 (41%), Positives = 14/24 (58%) Frame = -3 Query: 106 ITTECGNMTGAMCSACVLGWVTTH 35 + ECG + GA+ VLGW + H Sbjct: 85 VARECGGLAGALSGGGVLGWASRH 108 >AB109390-1|BAF02295.1| 531|Homo sapiens Serase-1B protein. Length = 531 Score = 30.3 bits (65), Expect = 6.7 Identities = 19/59 (32%), Positives = 27/59 (45%), Gaps = 5/59 (8%) Frame = +2 Query: 326 DACCCREAVIGVVGSAEETVA-----SIRSSTAYTTRHANALRGKRSHTGPLRQTRPVH 487 DA CCR A IGVV ++ + + S+ + H LRG R + R+T H Sbjct: 22 DAACCRAATIGVVATSLVVLTLGVLLAFLSTQGFHVDHTAELRGIRWTSSLRRETSDYH 80 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 91,155,341 Number of Sequences: 237096 Number of extensions: 1750353 Number of successful extensions: 9182 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 8850 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9182 length of database: 76,859,062 effective HSP length: 88 effective length of database: 55,994,614 effective search space used: 7839245960 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -