BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060250.seq (686 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC23G3.07c |snf30||SWI/SNF complex subunit Snf30|Schizosacchar... 27 2.5 SPBC21C3.12c |||DUF953 family protein|Schizosaccharomyces pombe|... 26 4.4 >SPAC23G3.07c |snf30||SWI/SNF complex subunit Snf30|Schizosaccharomyces pombe|chr 1|||Manual Length = 274 Score = 27.1 bits (57), Expect = 2.5 Identities = 14/41 (34%), Positives = 20/41 (48%) Frame = -3 Query: 306 SRVPAQHACTEETGRSSTPCTSNRHN*FNDSSVAETRARAL 184 S+ + + RS TP N + F DS A+ +ARAL Sbjct: 222 SKFRTDNYLARSSNRSGTPNIQNEQSRFFDSQQAQVQARAL 262 >SPBC21C3.12c |||DUF953 family protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 124 Score = 26.2 bits (55), Expect = 4.4 Identities = 9/24 (37%), Positives = 11/24 (45%) Frame = -3 Query: 459 TVEPWCPAARGTRPAVGTHFYSKR 388 T +PWCP R P F S + Sbjct: 34 TKQPWCPTVRAALPLFNNAFNSSK 57 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,737,584 Number of Sequences: 5004 Number of extensions: 54527 Number of successful extensions: 102 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 99 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 102 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 317927284 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -