BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060249.seq (678 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_50651| Best HMM Match : Retrotrans_gag (HMM E-Value=2) 29 4.6 SB_57369| Best HMM Match : Phage_fiber_2 (HMM E-Value=4.9) 29 4.6 SB_11435| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 >SB_50651| Best HMM Match : Retrotrans_gag (HMM E-Value=2) Length = 211 Score = 28.7 bits (61), Expect = 4.6 Identities = 11/32 (34%), Positives = 20/32 (62%) Frame = +2 Query: 77 WRIPLMELNYKFKQINETFQVFFTNYLNIIKK 172 + IP+ EL + ++ +VFFT Y+N+ +K Sbjct: 56 YAIPIAELTTEMAKLLRDVKVFFTKYINLERK 87 >SB_57369| Best HMM Match : Phage_fiber_2 (HMM E-Value=4.9) Length = 138 Score = 28.7 bits (61), Expect = 4.6 Identities = 11/32 (34%), Positives = 20/32 (62%) Frame = +2 Query: 77 WRIPLMELNYKFKQINETFQVFFTNYLNIIKK 172 + IP+ EL + ++ +VFFT Y+N+ +K Sbjct: 56 YAIPIAELTTEMAKLLRDVKVFFTKYINLERK 87 >SB_11435| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 618 Score = 28.3 bits (60), Expect = 6.0 Identities = 14/49 (28%), Positives = 25/49 (51%) Frame = -1 Query: 450 AFPPKNSRWQCCHYKNAQPSNATASFMILLINDFRLTQGYPHGTFRKIK 304 +F N++ C KNA+ +N + +++ L NDF+ +FR K Sbjct: 159 SFATANNKTCNCRQKNAKDNNTSETYVGLTENDFKTRYRNHTASFRHAK 207 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,465,569 Number of Sequences: 59808 Number of extensions: 342414 Number of successful extensions: 562 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 543 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 561 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1745338465 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -