BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060247.seq (690 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_04_0204 - 18444903-18445054,18445445-18445676,18445765-184458... 28 8.0 >03_04_0204 - 18444903-18445054,18445445-18445676,18445765-18445836, 18446201-18446347,18446559-18446614,18446727-18446832, 18446938-18447025,18447112-18447230,18448975-18449580, 18449803-18449898,18450232-18450422,18453287-18453416, 18453531-18453566 Length = 676 Score = 27.9 bits (59), Expect = 8.0 Identities = 15/43 (34%), Positives = 26/43 (60%), Gaps = 4/43 (9%) Frame = +1 Query: 310 HDVTNISGISMKQYEEQLNGLRKENFHL----KLRIYFLEEKL 426 +DVT +SG+++++ EEQL KE + ++ + EEKL Sbjct: 411 NDVTAVSGVNLREEEEQLFSAPKEESRVSEAARMVVQLEEEKL 453 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,021,608 Number of Sequences: 37544 Number of extensions: 274387 Number of successful extensions: 554 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 545 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 554 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1756684372 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -