BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060246.seq (635 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC2D10.10c |fib1|fib|fibrillarin|Schizosaccharomyces pombe|chr... 71 1e-13 >SPBC2D10.10c |fib1|fib|fibrillarin|Schizosaccharomyces pombe|chr 2|||Manual Length = 305 Score = 70.9 bits (166), Expect = 1e-13 Identities = 32/43 (74%), Positives = 36/43 (83%) Frame = +1 Query: 382 QVIIEPHRHPGVFIAXGKEDALVXKNLVPGSQVYGEKRISVET 510 +VIIEPHRH GVFIA GKED LV +NLVPG VY EKRISV++ Sbjct: 72 KVIIEPHRHAGVFIARGKEDLLVTRNLVPGESVYNEKRISVDS 114 Score = 27.1 bits (57), Expect = 2.3 Identities = 13/25 (52%), Positives = 18/25 (72%), Gaps = 2/25 (8%) Frame = +3 Query: 477 SLW*KENIS*D--EGDKVXYRVWNP 545 S++ ++ IS D +G KV YRVWNP Sbjct: 103 SVYNEKRISVDSPDGTKVEYRVWNP 127 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,464,242 Number of Sequences: 5004 Number of extensions: 18771 Number of successful extensions: 31 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 29 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 31 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 283719918 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -