BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060244.seq (677 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ667192-1|ABG75744.1| 489|Apis mellifera pH-sensitive chloride... 28 0.094 DQ667191-1|ABG75743.1| 475|Apis mellifera pH-sensitive chloride... 28 0.094 DQ667189-1|ABG75741.1| 458|Apis mellifera pH-sensitive chloride... 28 0.094 DQ667190-1|ABG75742.1| 509|Apis mellifera pH-sensitive chloride... 27 0.22 AB167961-1|BAD51404.1| 554|Apis mellifera E74 protein. 23 2.0 DQ667182-1|ABG75734.1| 445|Apis mellifera GABA-gated chloride c... 23 2.7 DQ667181-1|ABG75733.1| 445|Apis mellifera GABA-gated chloride c... 23 2.7 AF094822-1|AAC63381.1| 365|Apis mellifera GABA receptor Rdl sub... 23 2.7 AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamat... 23 3.5 DQ667195-1|ABG75747.1| 469|Apis mellifera cys-loop ligand-gated... 21 8.2 >DQ667192-1|ABG75744.1| 489|Apis mellifera pH-sensitive chloride channel variant 4 protein. Length = 489 Score = 27.9 bits (59), Expect = 0.094 Identities = 22/75 (29%), Positives = 32/75 (42%), Gaps = 4/75 (5%) Frame = +3 Query: 303 DTAIEPVYPGCDYKTVAALMMEPRDPDSLEIRHKGEFSNQFPWVD--LPYENGAQ--TLS 470 D + P G V+ L++ PD ++++ EF Q W D L Y N +Q L+ Sbjct: 75 DKRLLPPVQGTLTVNVSVLLLSLASPDESSLKYEVEFLLQQQWYDPRLRYSNRSQYEFLN 134 Query: 471 VIAPKHDSKYDPTYF 515 I D TYF Sbjct: 135 AIHHYDDIWLPDTYF 149 >DQ667191-1|ABG75743.1| 475|Apis mellifera pH-sensitive chloride channel variant 3 protein. Length = 475 Score = 27.9 bits (59), Expect = 0.094 Identities = 22/75 (29%), Positives = 32/75 (42%), Gaps = 4/75 (5%) Frame = +3 Query: 303 DTAIEPVYPGCDYKTVAALMMEPRDPDSLEIRHKGEFSNQFPWVD--LPYENGAQ--TLS 470 D + P G V+ L++ PD ++++ EF Q W D L Y N +Q L+ Sbjct: 75 DKRLLPPVQGTLTVNVSVLLLSLASPDESSLKYEVEFLLQQQWYDPRLRYSNRSQYEFLN 134 Query: 471 VIAPKHDSKYDPTYF 515 I D TYF Sbjct: 135 AIHHYDDIWLPDTYF 149 >DQ667189-1|ABG75741.1| 458|Apis mellifera pH-sensitive chloride channel protein. Length = 458 Score = 27.9 bits (59), Expect = 0.094 Identities = 22/75 (29%), Positives = 32/75 (42%), Gaps = 4/75 (5%) Frame = +3 Query: 303 DTAIEPVYPGCDYKTVAALMMEPRDPDSLEIRHKGEFSNQFPWVD--LPYENGAQ--TLS 470 D + P G V+ L++ PD ++++ EF Q W D L Y N +Q L+ Sbjct: 75 DKRLLPPVQGTLTVNVSVLLLSLASPDESSLKYEVEFLLQQQWYDPRLRYSNRSQYEFLN 134 Query: 471 VIAPKHDSKYDPTYF 515 I D TYF Sbjct: 135 AIHHYDDIWLPDTYF 149 >DQ667190-1|ABG75742.1| 509|Apis mellifera pH-sensitive chloride channel variant 1 protein. Length = 509 Score = 26.6 bits (56), Expect = 0.22 Identities = 19/60 (31%), Positives = 28/60 (46%), Gaps = 4/60 (6%) Frame = +3 Query: 348 VAALMMEPRDPDSLEIRHKGEFSNQFPWVD--LPYENGAQ--TLSVIAPKHDSKYDPTYF 515 V+ L++ PD ++++ EF Q W D L Y N +Q L+ I D TYF Sbjct: 141 VSVLLLSLASPDESSLKYEVEFLLQQQWYDPRLRYSNRSQYEFLNAIHHYDDIWLPDTYF 200 >AB167961-1|BAD51404.1| 554|Apis mellifera E74 protein. Length = 554 Score = 23.4 bits (48), Expect = 2.0 Identities = 11/37 (29%), Positives = 19/37 (51%) Frame = -2 Query: 337 SQPG*TGSMAVSVGSTLLMSTLVGREEGYRNGEDDGF 227 ++PG TG+ S G+ LL L + + G +G+ Sbjct: 174 AEPGSTGTTTTSTGTRLLHGILSQHPQQHGLGVQNGY 210 >DQ667182-1|ABG75734.1| 445|Apis mellifera GABA-gated chloride channel protein. Length = 445 Score = 23.0 bits (47), Expect = 2.7 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = -1 Query: 515 KVSRVIFRVMFGCYN 471 K SR++F V F C+N Sbjct: 406 KYSRIVFPVCFVCFN 420 >DQ667181-1|ABG75733.1| 445|Apis mellifera GABA-gated chloride channel protein. Length = 445 Score = 23.0 bits (47), Expect = 2.7 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = -1 Query: 515 KVSRVIFRVMFGCYN 471 K SR++F V F C+N Sbjct: 406 KYSRIVFPVCFVCFN 420 >AF094822-1|AAC63381.1| 365|Apis mellifera GABA receptor Rdl subunit protein. Length = 365 Score = 23.0 bits (47), Expect = 2.7 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = -1 Query: 515 KVSRVIFRVMFGCYN 471 K SR++F V F C+N Sbjct: 344 KYSRIVFPVCFVCFN 358 >AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamate receptor protein. Length = 1040 Score = 22.6 bits (46), Expect = 3.5 Identities = 8/11 (72%), Positives = 10/11 (90%) Frame = -3 Query: 93 MSWIEFKIGHP 61 MS I+FK+GHP Sbjct: 570 MSAIQFKLGHP 580 >DQ667195-1|ABG75747.1| 469|Apis mellifera cys-loop ligand-gated ion channel subunit protein. Length = 469 Score = 21.4 bits (43), Expect = 8.2 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = -1 Query: 527 QWRPKVSRVIFRVMFGCYN 471 QW + SR++F V F +N Sbjct: 442 QWIDRRSRIVFPVAFIIFN 460 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 211,361 Number of Sequences: 438 Number of extensions: 5846 Number of successful extensions: 16 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 15 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 16 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 20586735 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -