BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060241.seq (575 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g02870.1 68418.m00230 60S ribosomal protein L4/L1 (RPL4D) 60S... 130 6e-31 At3g09630.1 68416.m01142 60S ribosomal protein L4/L1 (RPL4A) str... 130 6e-31 At1g76010.1 68414.m08825 expressed protein 30 1.3 At1g57750.1 68414.m06552 cytochrome P450, putative similar to cy... 29 1.7 At5g55100.2 68418.m06869 SWAP (Suppressor-of-White-APricot)/surp... 29 2.2 At5g55100.1 68418.m06868 SWAP (Suppressor-of-White-APricot)/surp... 29 2.2 At2g05520.1 68415.m00584 glycine-rich protein (GRP) identical to... 29 2.2 At3g22330.1 68416.m02820 DEAD box RNA helicase, putative similar... 29 2.9 At3g04640.1 68416.m00497 glycine-rich protein predicted proteins... 29 2.9 At1g48410.2 68414.m05409 argonaute protein (AGO1) identical to S... 29 2.9 At1g48410.1 68414.m05408 argonaute protein (AGO1) identical to S... 29 2.9 At4g39480.1 68417.m05585 cytochrome P450 family protein contains... 28 3.9 At5g17650.1 68418.m02069 glycine/proline-rich protein glycine/pr... 28 5.1 At3g12430.1 68416.m01548 expressed protein ; expression supporte... 28 5.1 At2g42200.2 68415.m05223 squamosa promoter-binding protein-like ... 27 6.8 At2g42200.1 68415.m05222 squamosa promoter-binding protein-like ... 27 6.8 At1g80480.1 68414.m09427 PRLI-interacting factor L, putative sim... 27 6.8 At1g10340.1 68414.m01164 ankyrin repeat family protein contains ... 27 6.8 At4g29230.1 68417.m04181 no apical meristem (NAM) family protein... 27 9.0 >At5g02870.1 68418.m00230 60S ribosomal protein L4/L1 (RPL4D) 60S roibosomal protein L4, Arabidopsis thaliana, EMBL:CAA79104 Length = 407 Score = 130 bits (314), Expect = 6e-31 Identities = 62/91 (68%), Positives = 69/91 (75%) Frame = +1 Query: 256 GHQTSAESWGTGRAVARIPRVRGGGTHRSGQGAFGNMCRGGRMFXPTKPXRRWHRRCQPX 435 GHQTSAESWGTGRAV+RIPRV GGGTHR+GQ AFGNMCRGGRMF PTK RRWHRR Sbjct: 65 GHQTSAESWGTGRAVSRIPRVPGGGTHRAGQAAFGNMCRGGRMFAPTKIWRRWHRRVN-V 123 Query: 436 DSGERPWPAAVAATGVPALVXAXRNIIEKIP 528 + +A+AAT VPALV A + IE +P Sbjct: 124 NMKRHAIVSAIAATAVPALVMARGHKIENVP 154 Score = 58.4 bits (135), Expect = 3e-09 Identities = 30/59 (50%), Positives = 37/59 (62%), Gaps = 2/59 (3%) Frame = +2 Query: 83 SVARPLVSVYSEKSE--TVQGAAKPLPFVFKAPIRPDLVNDVHVSMSKNSRQPYCVSKE 253 + ARPLV+V + T Q LP V AP+RPD+VN VH +S NSRQPY VSK+ Sbjct: 5 AAARPLVTVQGLDGDMSTDQSTTVTLPDVMTAPVRPDIVNFVHAQISNNSRQPYAVSKK 63 >At3g09630.1 68416.m01142 60S ribosomal protein L4/L1 (RPL4A) strong similarity to 60S ribosomal protein L1 GB:P49691 Length = 406 Score = 130 bits (314), Expect = 6e-31 Identities = 62/91 (68%), Positives = 69/91 (75%) Frame = +1 Query: 256 GHQTSAESWGTGRAVARIPRVRGGGTHRSGQGAFGNMCRGGRMFXPTKPXRRWHRRCQPX 435 GHQTSAESWGTGRAV+RIPRV GGGTHR+GQ AFGNMCRGGRMF PTK RRWHRR Sbjct: 64 GHQTSAESWGTGRAVSRIPRVPGGGTHRAGQAAFGNMCRGGRMFAPTKIWRRWHRRVN-V 122 Query: 436 DSGERPWPAAVAATGVPALVXAXRNIIEKIP 528 + +A+AAT VPALV A + IE +P Sbjct: 123 NMKRHAIVSAIAATAVPALVMARGHKIENVP 153 Score = 60.5 bits (140), Expect = 8e-10 Identities = 30/62 (48%), Positives = 41/62 (66%), Gaps = 2/62 (3%) Frame = +2 Query: 74 MSLSVARPLVSVYSEKSE--TVQGAAKPLPFVFKAPIRPDLVNDVHVSMSKNSRQPYCVS 247 M+ + ARPLV++ + + T Q + LP V AP+RPD+VN VH +S NSRQPY VS Sbjct: 1 MAAAAARPLVTIQTLDGDMSTDQSSTVVLPDVMTAPVRPDIVNFVHAQISNNSRQPYAVS 60 Query: 248 KE 253 K+ Sbjct: 61 KK 62 >At1g76010.1 68414.m08825 expressed protein Length = 350 Score = 29.9 bits (64), Expect = 1.3 Identities = 18/43 (41%), Positives = 19/43 (44%) Frame = +1 Query: 247 QGGGHQTSAESWGTGRAVARIPRVRGGGTHRSGQGAFGNMCRG 375 QG G + G GR R R RGGG R G G F N G Sbjct: 303 QGRGGYDGPQGRGRGRGRGRGGRGRGGG--RGGDGGFNNRSDG 343 >At1g57750.1 68414.m06552 cytochrome P450, putative similar to cytochrome P450 GI:4688670 from [Catharanthus roseus] Length = 497 Score = 29.5 bits (63), Expect = 1.7 Identities = 16/49 (32%), Positives = 29/49 (59%) Frame = +2 Query: 98 LVSVYSEKSETVQGAAKPLPFVFKAPIRPDLVNDVHVSMSKNSRQPYCV 244 LV +++ SE+++ PLPF K+P +PD++ H + NS+ C+ Sbjct: 351 LVYLHAALSESMR-LYPPLPFNHKSPAKPDVLPSGH-KVDANSKIVICI 397 >At5g55100.2 68418.m06869 SWAP (Suppressor-of-White-APricot)/surp domain-containing protein contains Pfam domain PF01805: Surp module Length = 844 Score = 29.1 bits (62), Expect = 2.2 Identities = 12/41 (29%), Positives = 21/41 (51%), Gaps = 1/41 (2%) Frame = -2 Query: 388 RTYVHHDTCYRRHPDRTY-EYHHHGHAEFGRQHVQYPMIQH 269 R++ H + +H D + E+HHH H R+H ++H Sbjct: 735 RSHHHRSRKHEKHRDSSDDEHHHHRHRSSRRKHEDSSDVEH 775 >At5g55100.1 68418.m06868 SWAP (Suppressor-of-White-APricot)/surp domain-containing protein contains Pfam domain PF01805: Surp module Length = 843 Score = 29.1 bits (62), Expect = 2.2 Identities = 12/41 (29%), Positives = 21/41 (51%), Gaps = 1/41 (2%) Frame = -2 Query: 388 RTYVHHDTCYRRHPDRTY-EYHHHGHAEFGRQHVQYPMIQH 269 R++ H + +H D + E+HHH H R+H ++H Sbjct: 735 RSHHHRSRKHEKHRDSSDDEHHHHRHRSSRRKHEDSSDVEH 775 >At2g05520.1 68415.m00584 glycine-rich protein (GRP) identical to glycine-rich protein; atGRP (GI:259447) [Arabidopsis thaliana] Length = 145 Score = 29.1 bits (62), Expect = 2.2 Identities = 17/44 (38%), Positives = 22/44 (50%) Frame = +1 Query: 247 QGGGHQTSAESWGTGRAVARIPRVRGGGTHRSGQGAFGNMCRGG 378 QGGG + G GR R +GGG + G G+ G+ CR G Sbjct: 79 QGGGGRYQG---GGGRYQGGGGRYQGGGGRQGGGGSGGSYCRHG 119 >At3g22330.1 68416.m02820 DEAD box RNA helicase, putative similar to RNA helicases GI:3775995, GI:3775987 from [Arabidopsis thaliana]; contains Pfam profiles PF00270: DEAD/DEAH box helicase, PF00271: Helicase conserved C-terminal domain Length = 616 Score = 28.7 bits (61), Expect = 2.9 Identities = 16/40 (40%), Positives = 22/40 (55%) Frame = +1 Query: 241 REQGGGHQTSAESWGTGRAVARIPRVRGGGTHRSGQGAFG 360 R GGG+ S+ +G GR+ R G + RSG G+FG Sbjct: 512 RSGGGGYGGSSGGYGGGRSGGSSNRY-SGDSDRSGFGSFG 550 >At3g04640.1 68416.m00497 glycine-rich protein predicted proteins, Arabidopsis thaliana Length = 159 Score = 28.7 bits (61), Expect = 2.9 Identities = 17/41 (41%), Positives = 23/41 (56%), Gaps = 3/41 (7%) Frame = +1 Query: 247 QGGGHQTSAESWGT---GRAVARIPRVRGGGTHRSGQGAFG 360 +GGG +S G+ G + IP + GGGTHRSG + G Sbjct: 99 RGGGGSSSRGGGGSSSRGGGLRPIP-IYGGGTHRSGHHSSG 138 >At1g48410.2 68414.m05409 argonaute protein (AGO1) identical to SP|O04379 Argonaute protein (AGO1) {Arabidopsis thaliana}; contains Pfam profiles PF02171: Piwi domain, PF02170: PAZ domain Length = 1050 Score = 28.7 bits (61), Expect = 2.9 Identities = 15/45 (33%), Positives = 22/45 (48%) Frame = +1 Query: 247 QGGGHQTSAESWGTGRAVARIPRVRGGGTHRSGQGAFGNMCRGGR 381 +G G + + G GR R +GGG H+ G+G +GGR Sbjct: 15 EGSGSREAGPVSGGGRGSQRGGFQQGGGQHQGGRGYTPQPQQGGR 59 >At1g48410.1 68414.m05408 argonaute protein (AGO1) identical to SP|O04379 Argonaute protein (AGO1) {Arabidopsis thaliana}; contains Pfam profiles PF02171: Piwi domain, PF02170: PAZ domain Length = 1048 Score = 28.7 bits (61), Expect = 2.9 Identities = 15/45 (33%), Positives = 22/45 (48%) Frame = +1 Query: 247 QGGGHQTSAESWGTGRAVARIPRVRGGGTHRSGQGAFGNMCRGGR 381 +G G + + G GR R +GGG H+ G+G +GGR Sbjct: 15 EGSGSREAGPVSGGGRGSQRGGFQQGGGQHQGGRGYTPQPQQGGR 59 >At4g39480.1 68417.m05585 cytochrome P450 family protein contains Pfam profile: PF00067 cytochrome P450 Length = 989 Score = 28.3 bits (60), Expect = 3.9 Identities = 12/32 (37%), Positives = 20/32 (62%) Frame = +2 Query: 149 PLPFVFKAPIRPDLVNDVHVSMSKNSRQPYCV 244 P+PF K+P +PD++ H + NSR +C+ Sbjct: 384 PVPFNHKSPAKPDVLPSGH-KVKANSRILFCL 414 Score = 27.5 bits (58), Expect = 6.8 Identities = 11/32 (34%), Positives = 20/32 (62%) Frame = +2 Query: 149 PLPFVFKAPIRPDLVNDVHVSMSKNSRQPYCV 244 P+PF K+P +PD++ H + NS+ +C+ Sbjct: 857 PVPFQHKSPTKPDVLPSGH-KVDANSKILFCL 887 >At5g17650.1 68418.m02069 glycine/proline-rich protein glycine/proline-rich protein GPRP - Arabidopsis thaliana, EMBL:X84315 Length = 173 Score = 27.9 bits (59), Expect = 5.1 Identities = 10/24 (41%), Positives = 12/24 (50%) Frame = -2 Query: 376 HHDTCYRRHPDRTYEYHHHGHAEF 305 HH Y H Y Y +HGH +F Sbjct: 122 HHHGHYGHHHGHGYGYGYHGHGKF 145 >At3g12430.1 68416.m01548 expressed protein ; expression supported by MPSS Length = 238 Score = 27.9 bits (59), Expect = 5.1 Identities = 12/40 (30%), Positives = 22/40 (55%), Gaps = 2/40 (5%) Frame = -1 Query: 152 GAWLHPAPSHSSLNTPTLKVGLPID--SFRYFSEAIPLKY 39 G W+H SH+ ++ L VG+ + Y+S + P++Y Sbjct: 38 GQWIHDVLSHNRFSSHPLVVGVGVQWTPSSYYSASSPVRY 77 >At2g42200.2 68415.m05223 squamosa promoter-binding protein-like 9 (SPL9) identical to squamosa promoter binding protein-like 9 [Arabidopsis thaliana] GI:5931673; contains Pfam profile PF03110: SBP domain Length = 369 Score = 27.5 bits (58), Expect = 6.8 Identities = 16/35 (45%), Positives = 19/35 (54%) Frame = +1 Query: 244 EQGGGHQTSAESWGTGRAVARIPRVRGGGTHRSGQ 348 E GGG S+ S G RVRGGG+ +SGQ Sbjct: 41 EDGGGGSGSSSSGGRSNR-----RVRGGGSGQSGQ 70 >At2g42200.1 68415.m05222 squamosa promoter-binding protein-like 9 (SPL9) identical to squamosa promoter binding protein-like 9 [Arabidopsis thaliana] GI:5931673; contains Pfam profile PF03110: SBP domain Length = 375 Score = 27.5 bits (58), Expect = 6.8 Identities = 16/35 (45%), Positives = 19/35 (54%) Frame = +1 Query: 244 EQGGGHQTSAESWGTGRAVARIPRVRGGGTHRSGQ 348 E GGG S+ S G RVRGGG+ +SGQ Sbjct: 41 EDGGGGSGSSSSGGRSNR-----RVRGGGSGQSGQ 70 >At1g80480.1 68414.m09427 PRLI-interacting factor L, putative similar to PRLI-interacting factor L [Arabidopsis thaliana] GI:11139268; contains Pfam profile PF02492: Cobalamin synthesis protein/P47K Length = 444 Score = 27.5 bits (58), Expect = 6.8 Identities = 9/28 (32%), Positives = 13/28 (46%) Frame = -2 Query: 376 HHDTCYRRHPDRTYEYHHHGHAEFGRQH 293 HHD + H D +++ HH H H Sbjct: 311 HHDHDHDHHHDHNHDHDHHHHDGHDHHH 338 >At1g10340.1 68414.m01164 ankyrin repeat family protein contains ankyrin repeat domains, Pfam:PF00023 Length = 578 Score = 27.5 bits (58), Expect = 6.8 Identities = 12/28 (42%), Positives = 18/28 (64%) Frame = +2 Query: 452 LGRQPLLLPASQRSXRLXGTLLKRFPEL 535 +G L+L S S + GT+L+RFP+L Sbjct: 131 IGLGELILAISSGSTSIVGTILERFPDL 158 >At4g29230.1 68417.m04181 no apical meristem (NAM) family protein similar to NAM family proteins GP|12751304|, GP|6223650|, GP|9758909 - Arabidopsis thaliana,PIR2:T04621 Length = 498 Score = 27.1 bits (57), Expect = 9.0 Identities = 12/49 (24%), Positives = 26/49 (53%) Frame = -2 Query: 337 YEYHHHGHAEFGRQHVQYPMIQHWFGDHLLAHAVGLPRVLGHRNVNIID 191 +++HHH H + ++H + + Q H ++ + L H ++NI+D Sbjct: 359 HDHHHHHHQQQQQRHHAFNISQ---PTHPISTIISPSTSLHHASINILD 404 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,648,455 Number of Sequences: 28952 Number of extensions: 245497 Number of successful extensions: 768 Number of sequences better than 10.0: 19 Number of HSP's better than 10.0 without gapping: 703 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 755 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 1121903184 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -