BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060235.seq (655 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY898652-1|AAX83121.1| 349|Apis mellifera AKH receptor protein. 23 3.4 DQ026037-1|AAY87896.1| 431|Apis mellifera nicotinic acetylcholi... 22 6.0 DQ288391-1|ABC41341.1| 630|Apis mellifera vasa protein protein. 21 7.9 AF004842-1|AAD01205.1| 598|Apis mellifera major royal jelly pro... 21 7.9 AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. 21 7.9 >AY898652-1|AAX83121.1| 349|Apis mellifera AKH receptor protein. Length = 349 Score = 22.6 bits (46), Expect = 3.4 Identities = 9/26 (34%), Positives = 14/26 (53%) Frame = -3 Query: 122 ILIHLPYHNCVRWFSRIHSFLKSPAF 45 I+ HL H V W+S+ +F P + Sbjct: 173 IVFHLETHPNVTWYSQCVTFNAFPTY 198 >DQ026037-1|AAY87896.1| 431|Apis mellifera nicotinic acetylcholine receptor alpha9subunit protein. Length = 431 Score = 21.8 bits (44), Expect = 6.0 Identities = 11/37 (29%), Positives = 18/37 (48%) Frame = -3 Query: 488 PNIKPWSPAPTSSSFLFSCTPAAMFGDCWSSASITLH 378 PN++P S +++ P M D W+S + LH Sbjct: 57 PNVRPISSHQIANNVTMQLLPKLMEFDDWTSV-MELH 92 >DQ288391-1|ABC41341.1| 630|Apis mellifera vasa protein protein. Length = 630 Score = 21.4 bits (43), Expect = 7.9 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = +2 Query: 512 MHAVDCSACTQTQSGK 559 M+ D AC QT SGK Sbjct: 231 MNGRDLMACAQTGSGK 246 >AF004842-1|AAD01205.1| 598|Apis mellifera major royal jelly protein MRJP5 protein. Length = 598 Score = 21.4 bits (43), Expect = 7.9 Identities = 9/26 (34%), Positives = 14/26 (53%) Frame = +1 Query: 112 WISIFVHIGICWRGSSRQNVRPNKRR 189 W+ + V +GI +G + VR N R Sbjct: 4 WLLLVVCLGIACQGITSVTVRENSPR 29 >AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. Length = 735 Score = 21.4 bits (43), Expect = 7.9 Identities = 10/35 (28%), Positives = 15/35 (42%) Frame = -1 Query: 523 NGMHSLSHLLHNRTSSPGLLPQLPRHFCSHAPQQQ 419 +G+H + LL SP L + + QQQ Sbjct: 69 SGIHQMQQLLQQHILSPTQLQSFMQQHSLYLQQQQ 103 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 201,901 Number of Sequences: 438 Number of extensions: 4112 Number of successful extensions: 10 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 19804986 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -