BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060232.seq (653 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292334-1|CAL23146.2| 390|Tribolium castaneum gustatory recept... 22 3.8 EF125544-1|ABL73928.1| 279|Tribolium castaneum obstractor B pro... 22 5.1 AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase ... 21 8.9 AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ... 21 8.9 AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ... 21 8.9 >AM292334-1|CAL23146.2| 390|Tribolium castaneum gustatory receptor candidate 13 protein. Length = 390 Score = 22.2 bits (45), Expect = 3.8 Identities = 17/49 (34%), Positives = 22/49 (44%) Frame = -3 Query: 255 RLLMESPASIILTASSKVQLPIFKRRIAVTSRSMHDISFTYDSDRYS*T 109 R L ESP I L +V+L +R + S S D DR+S T Sbjct: 2 RFLGESPNGIYLYHDGRVKLLEGRRVVDCDDVSSVSQSEAGDEDRFSFT 50 >EF125544-1|ABL73928.1| 279|Tribolium castaneum obstractor B protein. Length = 279 Score = 21.8 bits (44), Expect = 5.1 Identities = 8/18 (44%), Positives = 12/18 (66%) Frame = -1 Query: 467 PFLMKCSKRPKIICKQPN 414 PF + C+ RPK+ QP+ Sbjct: 87 PFNIDCTSRPKLQEPQPS 104 >AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase protein. Length = 677 Score = 21.0 bits (42), Expect = 8.9 Identities = 11/32 (34%), Positives = 14/32 (43%) Frame = -3 Query: 528 CTTIRQRAIRVEHVGDVQQFSVSHEMFKAAQN 433 CT + QR RVE+ F+ E F N Sbjct: 584 CTLLLQRGYRVEYSAASDAFTHCPEGFNEFYN 615 >AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase protein. Length = 1464 Score = 21.0 bits (42), Expect = 8.9 Identities = 11/32 (34%), Positives = 14/32 (43%) Frame = -3 Query: 528 CTTIRQRAIRVEHVGDVQQFSVSHEMFKAAQN 433 CT + QR RVE+ F+ E F N Sbjct: 817 CTLLLQRGYRVEYSAASDAFTHCPEGFNEFYN 848 >AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2 protein. Length = 1464 Score = 21.0 bits (42), Expect = 8.9 Identities = 11/32 (34%), Positives = 14/32 (43%) Frame = -3 Query: 528 CTTIRQRAIRVEHVGDVQQFSVSHEMFKAAQN 433 CT + QR RVE+ F+ E F N Sbjct: 817 CTLLLQRGYRVEYSAASDAFTHCPEGFNEFYN 848 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 159,360 Number of Sequences: 336 Number of extensions: 3473 Number of successful extensions: 15 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 15 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 15 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 16865010 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -