BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060230.seq (655 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value U63132-1|AAB38392.1| 372|Tribolium castaneum decapentaplegic pr... 23 1.7 AM292339-1|CAL23151.2| 387|Tribolium castaneum gustatory recept... 22 5.1 AM292338-1|CAL23150.2| 372|Tribolium castaneum gustatory recept... 22 5.1 >U63132-1|AAB38392.1| 372|Tribolium castaneum decapentaplegic protein protein. Length = 372 Score = 23.4 bits (48), Expect = 1.7 Identities = 12/41 (29%), Positives = 24/41 (58%) Frame = -1 Query: 643 SVKRESLPFGPVGPIIVIGPLAHILLMYPGSVLLKKFSKLI 521 S+K + +P GP +G ++ + L GSV+LK + +++ Sbjct: 326 SMKPKEVP-GPCCVPTQLGQMSMLYLGSDGSVILKNYKEMV 365 >AM292339-1|CAL23151.2| 387|Tribolium castaneum gustatory receptor candidate 18 protein. Length = 387 Score = 21.8 bits (44), Expect = 5.1 Identities = 9/14 (64%), Positives = 12/14 (85%) Frame = -2 Query: 231 LLISYVLSSGTSFK 190 L++ VLSSGT+FK Sbjct: 83 LMVVAVLSSGTTFK 96 >AM292338-1|CAL23150.2| 372|Tribolium castaneum gustatory receptor candidate 17 protein. Length = 372 Score = 21.8 bits (44), Expect = 5.1 Identities = 9/14 (64%), Positives = 12/14 (85%) Frame = -2 Query: 231 LLISYVLSSGTSFK 190 L++ VLSSGT+FK Sbjct: 83 LMVVAVLSSGTTFK 96 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 157,901 Number of Sequences: 336 Number of extensions: 3505 Number of successful extensions: 7 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 16865010 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -