BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060230.seq (655 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 11_06_0091 + 19967390-19969825 29 3.2 01_06_0390 - 28938485-28938751,28939924-28941282 27 9.9 >11_06_0091 + 19967390-19969825 Length = 811 Score = 29.1 bits (62), Expect = 3.2 Identities = 14/43 (32%), Positives = 28/43 (65%) Frame = -1 Query: 634 RESLPFGPVGPIIVIGPLAHILLMYPGSVLLKKFSKLIYFCML 506 ++SL GP +V+G +A + +++ ++L KK ++ YFC+L Sbjct: 748 KQSLGMGPFSLGVVLGFIAGLWVVFC-TLLFKKSWRVAYFCLL 789 >01_06_0390 - 28938485-28938751,28939924-28941282 Length = 541 Score = 27.5 bits (58), Expect = 9.9 Identities = 15/43 (34%), Positives = 24/43 (55%), Gaps = 1/43 (2%) Frame = +1 Query: 451 ESNDFCIFVKPFILKKHYEAYKNILILKIFSRAPTL-DTLTKC 576 ES C+ + PFIL+ ++ + +I S +PTL D + KC Sbjct: 428 ESAQICLLL-PFILQSRAHRLHSVELPRIVSCSPTLEDCIVKC 469 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,230,941 Number of Sequences: 37544 Number of extensions: 306407 Number of successful extensions: 756 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 734 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 756 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1632177336 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -