BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060230.seq (655 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_51313| Best HMM Match : Pkinase (HMM E-Value=0.43) 31 1.1 SB_36542| Best HMM Match : Pox_A_type_inc (HMM E-Value=7.3e-11) 28 7.6 >SB_51313| Best HMM Match : Pkinase (HMM E-Value=0.43) Length = 456 Score = 30.7 bits (66), Expect = 1.1 Identities = 15/40 (37%), Positives = 21/40 (52%) Frame = +1 Query: 403 EKQAVQQTLDGHDWVLESNDFCIFVKPFILKKHYEAYKNI 522 EKQ V LDG W +ES C+ + F L + + KN+ Sbjct: 175 EKQLVYM-LDGERWTVESRGLCVSLIDFTLSRLRKVKKNV 213 >SB_36542| Best HMM Match : Pox_A_type_inc (HMM E-Value=7.3e-11) Length = 1500 Score = 27.9 bits (59), Expect = 7.6 Identities = 15/38 (39%), Positives = 21/38 (55%), Gaps = 1/38 (2%) Frame = +1 Query: 292 EYVNNFQQFLNTIRNNF-NGPCAKHDMGSSCEDTEEAT 402 E N+ Q+ L T+RNNF N ++HD+ EE T Sbjct: 516 ELNNSLQRQLETLRNNFINRSPSRHDLEELARLREEVT 553 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,898,131 Number of Sequences: 59808 Number of extensions: 407861 Number of successful extensions: 948 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 795 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 936 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1669334250 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -